KEGG   Intrasporangium calvum: Intca_2932Help
Entry
Intca_2932        CDS       T01385                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ica  Intrasporangium calvum
Pathway
ica00010  Glycolysis / Gluconeogenesis
ica00260  Glycine, serine and threonine metabolism
ica00680  Methane metabolism
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01130  Biosynthesis of antibiotics
ica01200  Carbon metabolism
ica01230  Biosynthesis of amino acids
Module
ica_M00002  Glycolysis, core module involving three-carbon compounds
ica_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_2932
  Energy metabolism
   00680 Methane metabolism
    Intca_2932
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_2932
Enzymes [BR:ica01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Intca_2932
Membrane trafficking [BR:ica04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Intca_2932
Exosome [BR:ica04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Intca_2932
  Exosomal proteins of melanoma cells
   Intca_2932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADU49427
UniProt: E6SAW6
Position
complement(3254566..3255309)
Genome map
AA seq 247 aa AA seqDB search
MTYTLVLVRHGESDWNAKNLFTGWVDVDLTEKGRAEAVRSGQQLKEAAILPDIVHTSVQR
RAITTANLSLDAADRHWIPVKRSWRLNERHYGALQGKNKKEILEQFGEEQFMQWRRSYDV
PPPPIDADDQYAQTGDPRYAGLGEAMPSTECLKDVVARMLPYWETEIKPDLADGLTVMVA
AHGNSLRALVKTLDEISDDDIAGLNIPTGMPLVYELDESFAPVARGGRYLDPEAALAAAE
AVAKQGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccctggtgctcgtccggcacggcgagagcgactggaacgcgaagaacctc
ttcaccggctgggtcgacgtcgacctgacggagaagggccgggccgaggcggtccgctcc
ggccagcagctcaaggaggcggcgatcctgccggacatcgtgcacacgtccgtgcagcgg
cgggccatcaccaccgcgaacctctcgctcgacgccgccgaccgccactggatcccggtc
aagcgcagctggcgtctcaacgagcggcactacggcgcgctgcagggcaagaacaagaag
gagatcctcgagcagttcggcgaggagcagttcatgcagtggcgtcgctcgtacgacgtg
ccgccgccacccatcgacgccgacgaccagtacgcccagaccggtgacccgcgctatgcg
ggcctgggcgaagccatgccgagcacggagtgcctcaaggacgtcgtcgcgcggatgctg
ccgtactgggagaccgagatcaagccggacctcgctgacggcctcaccgtcatggtcgct
gcgcacggcaactcgctgcgcgccctcgtcaagaccctcgacgagatcagcgacgacgac
atcgcagggctcaacatcccgaccgggatgccgctggtgtacgagctggacgagtcgttc
gctcccgtcgcccggggcggccgctacctcgaccccgaggccgccctggccgccgcagag
gccgtggccaagcaaggccgctga

DBGET integrated database retrieval system