KEGG   Intrasporangium calvum: Intca_3197Help
Entry
Intca_3197        CDS       T01385                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ica  Intrasporangium calvum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Intca_3197
Enzymes [BR:ica01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Intca_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3530814..3532046)
Genome map
AA seq 410 aa AA seqDB search
MRVITERASGVQLHITSLPDGGLGASARAFVDWLAAAGQSVWQVLPVSVPDVHGSPYKSP
SAFAVSPALLEHPDAPVSADELAHFADRESYWVGSWTAFGGDLADQVRFAREWAALRAYA
VERGVRMMGDVPIYVAPDGADVRAWPHLFRSDAVAGCPPDAYAATGQLWGNPLYRWDVMA
DEGFRWWVERLRRTFELFDFVRLDHFRGFAGYWAIPADAETAMSGHWEPGPGRALFDAAR
SELGDLPMLAEDLGDIDAPVVELRQALGLPGMAVLQFGFTPWDPHNIHHPSRLRPDQVVY
TGTHDNDTVRGWWAQQPEEVRDMVRGACWDRGVRAHVDDEPSWAFIELALTMPGELTMMQ
AQDVLGLGSEARMNTPGIEGGWGWRMEPGALTDAHAERLRSLTDAAGRAR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgatcaccgagcgcgccagcggcgtccagctgcacatcacctcattgccggac
ggaggactgggcgcatccgcgcgcgccttcgtcgactggctggcggcggccgggcagtcg
gtgtggcaggtgctgccggtctccgttcctgatgtgcacggttccccgtacaagtcgccg
tccgccttcgccgtgtcgccggcgctcctcgagcatcccgacgctcccgtcagcgcggac
gagctcgcgcacttcgcggaccgggagtcctactgggtcggctcgtggaccgcgttcggg
ggcgacctggccgaccaggtgcggttcgcccgcgagtgggccgcgctgcgcgcctacgcg
gtcgagcgcggggtgcggatgatgggcgacgtgccgatctacgtcgcaccggacggcgcc
gacgtccgcgcgtggccgcacctgttccgcagcgacgccgtcgccggctgccccccggac
gcctacgccgcgacgggccagctgtggggcaacccgctctaccggtgggacgtcatggcg
gacgaggggttccggtggtgggtcgagcggctgcggcgcaccttcgagctgttcgacttc
gtgcgcctcgaccacttccgcgggttcgccggctactgggccatccccgccgacgccgag
acggcgatgagcgggcactgggagcccggcccgggacgcgcgctcttcgacgccgcgcgc
tccgagctgggcgacctgccgatgctcgccgaggacctcggggacatcgacgcgccggtc
gtcgagctgcgccaggcgctcgggctcccgggcatggcggtcctccagttcggcttcacg
ccgtgggacccgcacaacatccaccacccgagccgccttcgccccgaccaggtcgtctac
accggcacccacgacaacgacaccgtgcgcggctggtgggcgcagcagcccgaggaggtg
cgggacatggttcgaggcgcctgctgggacaggggagttcgcgcccacgtcgacgacgag
ccgtcctgggccttcatcgagctcgccctcacgatgcccggtgagctgacgatgatgcag
gcgcaggacgtgctgggtctcggctccgaggcgcggatgaacacccccgggatcgagggc
ggctggggctggcggatggagccgggcgcgctcaccgacgcccacgccgagcggttgcgc
tccctgaccgacgccgccggccgagcgcggtag

DBGET integrated database retrieval system