KEGG   Intrasporangium calvum: Intca_3217Help
Entry
Intca_3217        CDS       T01385                                 

Definition
maltooligosyl trehalose hydrolase (EC:3.2.1.141)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ica  Intrasporangium calvum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Intca_3217
Enzymes [BR:ica01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Intca_3217
Exosome [BR:ica04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Intca_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3551816..3553552
Genome map
AA seq 578 aa AA seqDB search
MSEPRTMGVGSIPLEGRTAFRVWAPHAESVAVAGSFNAWSPDRHRLEREDAGHWYGEVEG
AGPGDEYKYVITTNGEQLHRVDPRAREVTNSVGNGVIYDRDAFDWHGDSFATPDHHELVI
YETHIGSFVAQEGDPGDIATMASRLGYLKSLGINAIELMPVAEFAGDYSWGYNPAHPFAV
ESTYGGPDRLKAFVREAHQHGIAVILDVVLNHFGPSDLSLWQFDGASDNGKGGIYFYQDD
RSHTPWGDTRPDYGREEVRQYCRDNALMWIEEFHMDGLRFDATLYIRTVSGVGTDIPEGW
ALMRDINLSIRQELPSKLLIAEDLQNDPALTSLDGAAFNAQWDAGFVHTLRALVTTPDDA
ARSMHDLAGVVAPRGNPWERVIYSESHDEVANGKFRVPHEIDPADPSGWPAQKRATLATA
IALTSAGIPMLFQGQEFLEDEWFRDTVPLDWERAESFRDIVRLVRDLVSLRRNLTGTTAG
LTGPHTDVTLVDDVAKTMAWVRSTDTESACVVVNASAEPREVTVGLPQPGRWAVRFNSDA
ATYSALFGGHSTLDVDAGEPAVATLSVGPYTLVVLSPA
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagccccgcaccatgggagtcggctccatcccgctcgagggccgcaccgcgttc
agagtctgggcgccccacgccgagtccgtcgcggtcgcgggcagcttcaacgcctggtcg
cccgaccggcaccggctcgagcgcgaggacgccggccactggtacggcgaggtcgagggc
gcggggccgggggacgagtacaagtacgtcatcacgaccaacggcgagcagctccatcgc
gtcgacccccgcgcccgcgaggtcaccaactccgtcggcaacggggtcatctacgaccgc
gacgccttcgactggcacggcgactcgttcgccacgccggaccaccacgagctcgtcatc
tacgagacccacatcgggtcgttcgtcgcacaggagggggaccccggcgacatcgcgacg
atggcgagccgcctcggctacctcaagagcctggggatcaacgcgatcgagctcatgccc
gtcgccgagttcgccggcgactactcgtggggctacaaccccgcgcatccgttcgccgtc
gagtcgacctatggcggccccgaccggctcaaggccttcgtgcgggaggcgcaccagcac
ggcatcgcggtgatcctcgacgtcgtcctcaaccacttcggcccgagcgacctgtcgctg
tggcagttcgacggcgcgtccgacaacggcaagggcggcatctacttctaccaggacgac
cgctcgcacaccccgtggggcgacacgcgccccgactacggtcgtgaggaggtccggcag
tactgccgcgacaacgcgctcatgtggatcgaggagttccacatggacgggctccgcttc
gatgccaccctctacatccggacggtgagcggcgtcggcaccgacatccccgagggctgg
gcgctgatgcgcgacatcaacctgagcatccggcaggagctgccgagcaagctcctcatc
gccgaggacctgcagaacgaccccgccctcacctcgctcgacggcgcggcgttcaacgcg
cagtgggacgccggcttcgtgcacaccctgcgcgccctggtcaccacaccggacgacgcg
gcccggtcgatgcacgacctcgccggcgtcgtcgcgccgcgcggcaacccgtgggagcgc
gtcatctactcggagagccacgacgaggtggccaacggcaagttccgggtgccgcacgag
atcgaccccgccgacccgtccgggtggcccgcgcagaagcgcgccaccctcgccacggcc
atcgccctgaccagcgccgggatcccgatgctcttccaggggcaggagttcctcgaggac
gagtggttccgggacaccgtgccgctggactgggagcgcgccgagtcgttccgggacatc
gtgcggctcgtccgggacctcgtctcgctccggcgcaacctgaccggcaccacggcgggg
ctcaccggaccacacaccgacgtgaccctggtggacgacgtggccaagacgatggcctgg
gtgcgctcgaccgacaccgagtcggcgtgtgtggtggtcaacgcgagtgccgagccgcgc
gaggtcaccgtcggcctcccccaacccggccggtgggcggtccgcttcaactccgacgcc
gcgacgtacagcgccctcttcggcggccactcgacgctcgacgtcgatgccggcgagccg
gccgtcgcgacgctctccgtcggcccctacacgctcgtcgtgctcagtccggcgtag

DBGET integrated database retrieval system