KEGG   Intrasporangium calvum: Intca_3236Help
Entry
Intca_3236        CDS       T01385                                 

Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ica  Intrasporangium calvum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Intca_3236
Enzymes [BR:ica01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Intca_3236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3570189..3571577)
Genome map
AA seq 462 aa AA seqDB search
MTQPPAITTLGALRASGHVQKHLRAELRDNLLEALREGRDPWPGLHGFADTVIPQIERAL
IAGHDVVLLGERGQGKTRLLRTLVGLLDEWTPVIEGAELGEHPYEPITPASTRRAAELGD
DLPVAWRHRDERYAEKLATPDTSVADLVGDVDPMKVAEGRLLGDPETIHFGLIPRSHRGI
VAINELPDLAERIQVAMLNVMEERDIQIRGYVLRLPLDVLVVASANPEDYTNRGRIITPL
KDRFGAEIRTHYPVAIEDEIAVIRQESRLQADVPDALVEVLARFARHLRESSAVDQRSGV
SARFAIAAAETIAAAARHRAATQGEDDAVARPVDLDGAVDVLGGKVEFETGEEGRERDIL
THLLRTAVAETVARHFRGIDFALLVDAIESGALVSTGEQVPARDVLAGLPVLGESELYDE
VWDRLAATNDGERASAIELALEGLYLARRISKETSGGETVYG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaaccccctgcgatcaccaccctcggggcgctgcgcgcctccggccacgtgcag
aagcacctcagggccgagctgcgcgacaaccttctcgaggcgctgcgtgaaggccgggac
ccgtggccggggctgcacggcttcgccgacacggtcatcccgcagatcgagcgcgccctc
atcgccgggcacgacgtcgtgctgctcggcgagcggggccagggcaagacccggctcctg
cggaccctggtcggcctgctcgacgagtggactcccgtgatcgagggggccgagctgggc
gagcacccctatgagccgatcaccccggcctccacacgccgggccgccgagctcggcgac
gacctgcccgtcgcgtggcggcaccgcgacgagcgctacgccgagaagctcgccaccccg
gacacctccgtggccgacctcgtcggggacgtcgacccgatgaaggtggccgagggacgg
ctgctcggtgaccccgagacgatccacttcggactcatcccgcgcagccaccgcggcatc
gtcgccatcaacgagctgcccgacctcgccgagcgcatccaggtcgcgatgctcaacgtc
atggaggagcgggacatccagatccgcggctacgtcctccggctgcccctcgacgtcctc
gtcgtggccagcgccaacccggaggactacacgaaccgcggccgcatcatcaccccgctc
aaggaccgcttcggcgcggagatccgcacgcactacccggtcgcgatcgaggacgagatc
gccgtgatccgtcaggagtcgcgactccaggccgacgtgcccgacgcgctcgtcgaggtg
ctggcccggttcgcccggcacctgcgcgagtcgagcgccgtggaccagcggtcgggggtg
agtgcccgcttcgcgatcgcggccgccgagaccatcgccgccgccgcccgccaccgggct
gccacccagggcgaggacgacgccgtcgcgcgccccgtcgacctcgacggagcggtcgac
gtcctcggcggcaaggtcgagttcgagaccggcgaggagggccgcgagcgcgacatcctc
acccacctgctccgcacggccgtcgccgagacggtcgcccggcacttccgggggatcgac
ttcgccctcctcgtcgacgcgatcgagagcggcgccctcgtgtcgaccggggagcaggtg
ccggcccgagacgtccttgcgggtctgccggtgctcggcgagtccgagctctacgacgag
gtgtgggaccggctcgcggccaccaacgacggcgagcgggccagcgccatcgagctcgcc
ctcgagggtctctacctcgcccgccggatcagcaaggagacgagcggcggggagacggtc
tacggatga

DBGET integrated database retrieval system