KEGG   Intrasporangium calvum: Intca_3322Help
Entry
Intca_3322        CDS       T01385                                 

Definition
class I and II aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ica  Intrasporangium calvum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Intca_3322
   01230 Biosynthesis of amino acids
    Intca_3322
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Intca_3322
   00290 Valine, leucine and isoleucine biosynthesis
    Intca_3322
Enzymes [BR:ica01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Intca_3322
    2.6.1.66  valine---pyruvate transaminase
     Intca_3322
Amino acid related enzymes [BR:ica01007]
 Aminotransferase (transaminase)
  Class I
   Intca_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3672974..3674188)
Genome map
AA seq 404 aa AA seqDB search
MRLVSQSKKLASVCYEIRGPVLAEAKRLEDEGHRILKLNIGNPAPFGFEAPDDILVDVIR
ALPTAQGYSDSKGIVSARRAIKQHYEVRDFPRLDIEDIYLGNGVSELIVMAMQGLLNNGD
EVLIPAPDYPLWTAAASLAGGTPVHYLCDEQAGWAPDLDDIASKITDRTKAIVVINPNNP
TGAVYPVDVLEGIAELARRHQLIIMADEIYDKILYDDAKHTSIAALAPDLFCLTFNGLSK
AYRVAGFRSGWLALTGPKEHARSYIEGLEVLANMRLCANVPAQHAIQVALGGYQSITELI
LPGGRLLEQRDRAWEMLNQIPGVSCTKPEGALYLFPRLDPKVHQIRDDERFAFDLLSEEK
LLVVHGTGFNWPSHDHFRLVFLPRVEELEDAMERIERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgtctcccagtccaagaagctcgcgtccgtctgctacgagatccgcggaccg
gtgctcgccgaggccaaacggctcgaggacgaggggcaccggatcctcaagctcaacatc
ggcaacccggcgccgttcggcttcgaggcgccggacgacatcctcgtcgacgtgatccgc
gcgctgccgaccgcacagggttacagcgacagcaagggcatcgtcagcgcgcgacgcgcc
atcaagcagcactacgaggtccgcgacttcccccgtctcgacatcgaggacatctacctg
ggaaacggcgtcagcgagctcatcgtcatggcgatgcagggcctgctcaacaacggcgac
gaggtcctcatcccggcgccggactacccgctgtggacggccgccgcgtccctggccggc
gggaccccggtgcactacctctgcgacgagcaggcgggctgggcgcccgacctcgacgac
atcgcgagcaagatcaccgaccggaccaaggcgatcgtcgtcatcaacccgaacaacccc
acgggcgccgtctacccggtcgacgtcctcgagggcatcgccgagctggcccgccggcac
cagctgatcatcatggccgacgagatctacgacaagatcctctacgacgacgcgaagcac
acgtcgatcgccgccctcgccccggacctgttctgcctcaccttcaacggcctctccaag
gcgtaccgcgtggccgggttccgttccgggtggctggccctcaccggcccgaaggagcac
gcccgcagctacatcgagggcctcgaggtcctcgcgaacatgcgtctgtgcgccaacgtg
ccggcccagcacgccatccaggtcgccctgggcggctaccagtcgatcaccgagctgatc
ctgccgggcggtcgactcctcgagcagcgcgaccgggcctgggagatgctcaaccagatc
ccgggggtctcgtgcaccaagccggagggtgcgctctacctcttcccgcgcctcgacccc
aaggtccaccagatccgggacgacgagcggttcgccttcgacctgctcagcgaggagaag
ctcctcgtcgtccacgggaccgggttcaactggccctcgcacgaccacttccggctcgtc
ttcctgccgcgggtggaggagctggaggacgcgatggagcggatcgagcgcttcctgtcg
acctacagccagtag

DBGET integrated database retrieval system