KEGG   Intrasporangium calvum: Intca_3417Help
Entry
Intca_3417        CDS       T01385                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ica  Intrasporangium calvum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ica00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3781917..3783425)
Genome map
AA seq 502 aa AA seqDB search
MDYVVAIDQGTTSTRAMVFDRAGSIVAMDQREHRQIFPRAGWVEHDPLEVWENTRAVVGG
ALGKANLDAKRIVAVGITNQRETTVVWDRATGRPVHNAIVWQDTRTQAICDELAGAVGPD
RFAERTGLPLATYFAGPKIRWILDHVDGARDRAEGGELLAGTMDTWILWNLTGGPDGGVH
VTDVTNASRTLLMDLRTLAWDEAIAAEMRVPVAMLPEIRSSSETYGTCQPGILLDVPVAG
ILGDQQAATFGQACLEPGMAKNTYGTGNFMLLNTGEEIVPSANGLLTTVCYRLGSAAPVY
ALEGSIAVTGSLVQWLRDNLGLIRDAAEVETLAASVDDNGGAYFVPAFSGLFAPHWRPDA
RGALVGLTRFVNRGHLARAALEATAFQTREVLDAMNADSGVPLTELRVDGGMVVNDTLMQ
FQADLLGVDVVRPRVAETTALGAAYAAGLAVGYWSGPSEVTANWGEDRRWSPSMDPAERA
RLYRNWKKAVQRTLDWVDADTP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggactacgtcgtcgcgatcgaccaggggaccacgagcacgcgggccatggtgttcgac
cgtgccggaagcatcgtcgcgatggaccagcgcgagcaccgtcagatcttcccccgggcc
ggctgggtcgagcacgaccccctcgaggtgtgggagaacacgcgggccgtcgtcgggggc
gccctcggcaaggcgaacctcgacgcgaagcgcatcgtcgcggtcggcatcaccaaccag
cgcgagacgaccgtcgtctgggaccgcgccaccgggcggcccgtccacaacgcgatcgtg
tggcaggacacgaggacccaggcgatctgtgacgagctcgccggcgcggtcgggcccgac
cgcttcgcggagcggaccgggttgccgctcgcgacgtacttcgccgggcccaagatccgc
tggatcctcgaccacgtcgacggcgcccgggaccgcgcggaggggggcgagctgctcgcg
gggacgatggacacctggatcctgtggaacctcaccggcggtcccgacggcggcgtccac
gtcaccgacgtgaccaacgcgagccgcacgctcctcatggacctgcggacgctcgcctgg
gacgaggcgatcgccgcggagatgcgggtgcccgtcgcgatgctcccggagatccgctcg
tcgtcggagacgtacggcacctgccagccgggcatcctgctcgacgtgccggtggcgggg
atcctcggcgaccagcaggcggcgaccttcggccaggcgtgcctcgagcccggaatggcc
aagaacacctacggcaccggcaacttcatgctcctcaacacgggggaggagatcgtgccg
tcggcgaacgggctgctgacgacggtctgctaccggctcggctcggctgcgcccgtctac
gccctcgagggctcgatcgcggtcaccgggtcactcgtccagtggctccgtgacaacctc
ggcctcatccgcgacgcggccgaggtggagacgctggcggcatcggtcgacgacaacggc
ggcgcctacttcgtccccgcgttctcggggctcttcgcgccgcactggcggccggacgcg
cggggcgcgctcgtggggctgacccgcttcgtcaacaggggccacctcgcgcgggcggcc
ctggaggcgaccgcgttccagacccgcgaggtgctggacgcgatgaacgcggactcaggc
gtcccgctgaccgagctgcgggtcgacggcgggatggtcgtcaacgacaccctcatgcag
ttccaggccgacctgctcggcgtcgacgtggtccgcccgagggtggccgagacgacggct
ctcggggcggcgtatgccgctgggctggcggtcgggtactggtcgggtcccagcgaggtg
accgccaactggggcgaggaccggcgctggtcgccgtcgatggacccggccgagcgcgcg
cgcctctaccgcaactggaagaaggccgtgcagcgcaccctcgactgggtcgacgccgac
accccctga

DBGET integrated database retrieval system