KEGG   Intrasporangium calvum: Intca_3457Help
Entry
Intca_3457        CDS       T01385                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ica  Intrasporangium calvum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Intca_3457
  Lipid metabolism
   00561 Glycerolipid metabolism
    Intca_3457
   00600 Sphingolipid metabolism
    Intca_3457
Enzymes [BR:ica01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Intca_3457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3833187..3835346
Genome map
AA seq 719 aa AA seqDB search
MADLRPVRRHEHLSAGGTSVIVEIGADTIPRVLHWGPDLGDLDDAALSAVADAARPTTGD
SVVTHQTSVPLVPQHGTGWLGRPGIAGNRIVDGRPGPGWSPLFTSVQHARADSDAVCRLV
SEGTDPVAELFLTTEVEVHPSGLVRVRATLRNDGTTPYVVGGLECALPVPAAADELLHLT
GHHTRERMPQRQPFTVGQLVREARGGRAGHDATTIVAAGVPGFGWRSGRVWSVHVAWNGN
QVTVAERTDGGWRLLRGGELLLPGEIVLDPGDTYPGPWLVASWGEGLDQLAGRHHDFLRA
RNQHPTRARPVLLNTWEAVYFDHDLDRLTALAEAGAEVGVERFVLDDGWFRGRRNDRSGL
GDWFVDETVWPGGLRPLVERVHALGMEFGLWFEPEMANLDSDLARAHPDWLLGVGRGPGP
ESRYQHVLDLSKDEVVSYVTERMSQLVGELDVAYVKWDHNRALVDAGSQPFGTPAGHANA
LAVPGIMAELKQRHPGLEIESCCGGGGRIDLGIIEVADRVWASDCIDAHDRLDIQRGTSL
LLPPELVGTHIGSPRAHTTGRVQPLSLRGGVALWGHLGIEWDLTRASAEDRAEVAEWVAL
HKALRPLLHTGRVVHADLSGDAFRLEGVVAQDGSRGIYGLAGYDRPLTSSYGRMPLGGLH
DDVTYRVSLLPPGDRATVGRRPVWLDSPVTLTGRVLREVGLEVPMLLPDGYLLIDASAD
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctgcgcccggtacggcgacacgagcacctcagcgccggcgggacgagcgtc
atcgtggagatcggcgccgacacgatcccgcgggtgctccactggggacccgacctcggt
gacctcgacgacgcagcgctgagcgcggtggccgacgcggcgcggcctacgactggcgac
tcggtcgtcacgcaccagacgtcggttccgctcgtcccgcagcacggcaccggctggctg
gggcggcccggcatcgcgggcaaccggatcgtcgatgggcgaccgggccccggctggtca
cccctcttcacctcggtgcagcatgcccgcgccgactccgacgcggtgtgccgcctcgtc
agcgagggaaccgacccggtcgccgagctgttcctcacgaccgaggtcgaggtgcacccg
agcggcctcgtgcgggtccgggccacgctgcgcaacgacggcaccacgccgtatgtcgtg
ggcggcctggagtgcgccctgcccgttccggccgccgccgacgagctgctgcacctcacc
ggccaccacacccgcgagcggatgccgcaacgccagccgttcaccgtgggacagctcgtg
cgcgaggcacgcggcggcagagcggggcacgacgccaccacgatcgtcgccgccggcgtc
ccgggcttcggctggcggtccgggcgcgtgtggtcggtccacgtcgcctggaacggcaac
caggtcaccgtcgccgagcgcaccgacggcggctggcggctgctgcgcggcggcgagctc
ctgctgcccggtgagatcgtgctcgaccccggcgacacctacccgggcccatggctcgtc
gcctcgtggggagagggcctcgaccagctcgccggacgtcaccacgacttcctgcgcgcc
cggaaccagcacccgacgcgggcccggccggtcctgctcaacacgtgggaggcagtctac
ttcgaccacgacctcgaccgcctgacagccctcgcggaggcgggcgccgaggtgggggtc
gagcggttcgtgctcgacgacgggtggttcagaggccgccgcaacgaccggtccggcctg
ggcgactggttcgtcgacgagaccgtctggcccggggggctccggccactggtcgagcgg
gtgcacgcgctcgggatggagttcgggctgtggttcgagccggagatggccaacctcgac
tcggacctcgcgcgcgcccaccccgactggctgctcggcgtcggccgcggcccggggccg
gagtcgcgctaccagcacgtcctcgacctgtcgaaggacgaggtcgtctcctacgtcacc
gagcggatgtcccagctcgtcggtgagctcgacgtcgcctacgtcaagtgggaccacaac
cgcgcgctcgtcgacgcgggcagccagccgttcggcacccctgccggccacgccaacgcc
ctcgccgtgccgggcatcatggccgagctcaagcagcgccatcccggtctcgagatcgag
tcctgctgcggcggcggtggccggatcgacctcggcatcatcgaggtcgccgaccgggtc
tgggcctcggactgcatcgacgcgcacgaccggctcgacatccagcgcgggacgagcctc
ctgctccccccggagctcgtcggcacccacatcggctcaccgcgagcgcacacgacgggg
cgcgtccagccgttgtcgctccgcggcggcgtcgccctgtggggccacctcgggatcgag
tgggacctcacccgcgcgagtgccgaggaccgggccgaggtggccgaatgggtcgccctg
cacaaggccctccgccccctgctccacaccggccgggtcgtgcacgccgacctctccggg
gacgcattccgactggagggcgttgtcgcccaggacggctcacgaggcatctacgggttg
gccgggtacgaccgcccactcacgtcctcctacggccgtatgccgctgggcgggctccac
gacgacgtgacctaccgcgtcagcctccttccccccggcgaccgggcgaccgtcgggcgc
cgaccggtgtggctggactcgcccgtcaccctgaccgggcgggtcctgcgtgaggtcggg
ctcgaggtgccgatgctgctgccggacggctacctgctcatcgacgccagcgccgactga

DBGET integrated database retrieval system