KEGG   Ignicoccus hospitalis: Igni_0025Help
Entry
Igni_0025         CDS       T00587                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
iho  Ignicoccus hospitalis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:iho01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:iho00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
24979..26793
Genome map
AA seq 604 aa AA seqDB search
MERKILFIDLSRTRIDEVEVDDYLHTRFLGGKGFCTYFIYKYAQPCADPYGPRNVAVIAA
GALAGYAPASGKTCFGAVSPLTGLIHDSYAGEVLGPKLRMAGYDAIVITGKSEEPVYIYV
TEEGTEILSADDIWGHSTSKATKVLKERHGKKSSVAVVGPAAENKVRYASVIVDYHRAAG
RGGIGAIWASKGLKAVVVKAAKPLPEPALGRKAWREVATKLYKKFQALGSSFSRYGTNNG
LVTADKLGMAPHYNFKYPHLGDVGELKGENVVKLAKGPHEVEDQSVFGYMCPIKCSKVVK
DEGIKSEYEHLGMLGAADGIYKLMDVLKAIKIVNDLGLDSISSGNVIGWTAESEEKGLLN
GVMKWGDGEKQRKLLEEIAYRKGIGAVLAEGVKRASEILGFGKEWAVHVKGLEAPAWDPR
GLLGFGLSYATADVGASHLRGWPRPHRPPTDSALKALDSLLYDRDKTSVADHMGTCVFLA
YDFPDWSELLKVVYGLDYDTEELRKLSQRTESLARLWALKVGYTSDDDTVPPRWMEPVPK
GPNAGLKAFISWEDLEVSKREYYKRRGWSPREGVPLPSTLKSLDLHFAVEDAELLLRKLE
PEYY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaggaaaatcttgtttatagacctttctagaactaggatagatgaagtagaggtt
gacgattaccttcatactagattcctaggagggaagggtttctgtacttactttatatat
aagtacgcgcagccttgtgcagacccctacgggcctcgaaacgtagctgtgatcgccgcc
ggcgcgctggccggctacgcgccggcgtccgggaagacttgcttcggtgccgtgagtcct
ctcaccggactgattcacgactcgtacgcgggagaggtgttaggccccaagctccggatg
gccggctacgatgcaatagttatcactgggaagtccgaagagccagtttacatctacgta
actgaggaggggaccgagatcctaagtgccgacgacatatggggtcatagcacctcaaag
gcgacgaaggtactcaaggagagacacggaaagaagagcagcgtagccgtcgtgggaccc
gccgccgagaacaaggttaggtacgcctcggtgatagtggactaccaccgggccgcgggg
cggggagggataggggccatctgggcgagcaaaggcttgaaggctgttgtagtcaaggca
gccaagcccctcccagagccggcgctggggaggaaggcgtggagggaagtggccaccaag
ctatacaagaagttccaagcgttgggctccagcttctctaggtacggaacaaacaacggc
ttggtgactgccgacaagttaggtatggccccgcactacaacttcaagtaccctcacctg
ggggacgtaggcgagcttaagggcgagaacgtcgtaaagctcgcgaagggtcctcacgaa
gtagaggaccagtccgtcttcggttacatgtgccccataaagtgttcaaaagtggtaaag
gatgaaggtatcaaaagcgagtacgaacacttgggcatgttgggcgcagcagacgggata
tacaagctaatggacgttctcaaagcgatcaaaatagtgaacgatctcggcttagatagc
atatcctctggcaacgtaataggttggaccgcagagagcgaggagaaggggttgctcaac
ggcgtaatgaagtggggagacggcgagaagcaaagaaagctgctagaggaaatagcgtac
agaaagggcataggcgcagtcctcgcggagggggtcaagagggcttccgaaatactgggc
ttcgggaaggagtgggcagtccacgtcaaagggttggaggcccccgcttgggaccccagg
ggactgttgggcttcgggctgagctacgccactgcagacgtgggggccagccacttgaga
ggctggccccgcccccatagacctcccacggacagcgcgctaaaggcgcttgactcctta
ttgtacgacagggacaagaccagcgtagctgatcacatgggtacgtgcgtgttcttggct
tacgactttccggactggagcgagctgttgaaggtagtatacggcttggattacgacacg
gaggagcttaggaagctctcccaaaggacggagagcttagcgcgattgtgggcactcaag
gtcggatatactagcgacgacgacaccgtcccgccccgctggatggagcccgtgcccaag
ggccccaacgccggcctcaaagccttcatctcatgggaagacttagaggtctctaagagg
gagtattacaagaggaggggttggagccctcgggaaggagttcccctcccttccaccctc
aagtcgctagaccttcacttcgcagtggaagacgccgaactcctcttgagaaagctagaa
cccgagtattactaa

DBGET integrated database retrieval system