KEGG   Ignicoccus hospitalis: Igni_0041Help
Entry
Igni_0041         CDS       T00587                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
iho  Ignicoccus hospitalis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Igni_0041
Enzymes [BR:iho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Igni_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
39256..40149
Genome map
AA seq 297 aa AA seqDB search
MVRIVVIGNINIDIIAFLDELPSIDEGREAKDWRVLPGGSGANFSVAARSLGADVELYAA
VGTGTFSKKVVEELERAGVKVFGPLKEGEQSMVFIASTPKGKVMYSLKGVSHSLRPEELP
ERFGADVVHVATKPPSFVEKYLSTERLSYSPGTYAFEETESVKRLVGRVDFLFLNKSEAM
RLGLYPEPEVLPREALVITLGGKGSLVYTRGGRAYYVESLKVEVVDTTGAGDVYAAAFLV
TYLTEGDIIKAAKAASAAGALAVTVPGGQIMLDVQSLKLAASKVGVREMRKSPTPEG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggtaaggatcgttgtaattggaaacattaacatagatataatagctttcttggacgag
ctcccctcaatagatgaggggagggaagctaaggactggcgggtgctcccaggaggctcc
ggggccaacttctcagtcgccgcccgtagcttaggggccgacgtagaactctacgccgcc
gtggggaccggcaccttctctaaaaaagtcgtggaggagcttgagagggccggagtcaaa
gtcttcggccctctgaaagagggcgaacagtcgatggtgttcatcgcttccactccgaaa
ggaaaagtcatgtactcgctgaagggcgtgtcccactcgctaaggccagaggagctgccc
gagaggttcggtgcggacgtagtccacgttgctaccaagcctccctcctttgtggagaag
tatctctctactgagagactcagttactcgcccggaacttacgctttcgaagagaccgag
tccgtcaagcgactcgtgggaagggttgactttctattcttaaataagtccgaagcaatg
aggttggggctgtaccccgagcccgaagtcctcccgagggaggcactcgttattacgctt
ggtggcaagggcagtctggtatataccagaggggggagggcatattacgttgagagcttg
aaggtggaagtagtagacactactggggccggcgatgtgtacgcagcggctttcttggtt
acgtatctcactgaaggcgatataatcaaggcggccaaggctgccagcgcggccggcgcg
ctcgcggtaaccgttcccggaggtcagataatgctagatgtccagagcttgaagctcgcg
gcctctaaggtcggagtgagggagatgaggaagagtccgacccctgaggggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system