KEGG   Ignicoccus hospitalis: Igni_0044Help
Entry
Igni_0044         CDS       T00587                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
iho  Ignicoccus hospitalis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:iho00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:iho00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(41646..42563)
Genome map
AA seq 305 aa AA seqDB search
MPDVVDVLDLDKKDMIKIFELAEDIEYKKLHKSKWCALENKTVSLLFVEPSTRTRLSFEE
SAKRLCAHTLTIVGEEASSFVKGESLYDTIKVLDKISDIIVIRHNLDGSAKYASEVAANP
VINAGDGKNQHPTQSLIDLYVVRKRKGGLEDLRYAVVGDLRYARTARSFLLALTKFKPRS
VYLVAPEVLKPSIKFLEELKSMGLNVFEVDRLEDVIPNVDVIYVTRIQKERFPDPSEYEK
VKGSYKITLDLIKRGKGDLIVLHPLPRVDELDVRIDSTPHAAYFDQVAASVPVRMATLAW
SAGVV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgccagacgtcgtagacgtcttggatttagataagaaagacatgatcaaaatattcgaa
ctcgctgaggacatagaatataagaaacttcataagtcgaagtggtgtgcccttgaaaac
aaaacagtgtcactccttttcgtcgaaccgtccactagaacgagactttcgttcgaagag
agcgccaagaggttgtgtgcccacacgctcacaatagtcggcgaggaagccagttcgttc
gtcaaaggtgagagcctatacgacactataaaagtcttagacaagattagcgacataata
gtgatcagacacaacttggacggctctgcgaagtacgcaagcgaggtcgccgcaaaccca
gtaattaacgcaggcgacggcaagaaccaacacccaacgcagtcgctcatagacctctac
gtagtcagaaagaggaaaggggggctcgaagaccttcgttacgctgtcgtgggggacctt
cggtacgctaggacggcgaggagcttcctgttggcgttgactaagtttaaacctaggtca
gtctacctagtagcccccgaagttctcaaaccctcaatcaagttcttagaagagttaaaa
tctatgggtctcaacgtttttgaagtagataggttggaggatgtcattcctaacgtcgac
gtaatatacgtaaccagaatacagaaggagaggtttccggacccctcagaatacgagaag
gttaaaggtagctacaaaataaccttagacctgataaagagggggaagggggacttgatc
gtcttacacccgctcccccgtgtggacgagttggacgtgagaatagactcgaccccccac
gcagcttacttcgaccaagtggctgcttccgtgccagtgagaatggcaacgctcgcttgg
agtgcgggggtggtctga

DBGET integrated database retrieval system