KEGG   Ignicoccus hospitalis: Igni_0086Help
Entry
Igni_0086         CDS       T00587                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
iho  Ignicoccus hospitalis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_0086
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Igni_0086
   00640 Propanoate metabolism
    Igni_0086
   00660 C5-Branched dibasic acid metabolism
    Igni_0086
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_0086
Enzymes [BR:iho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Igni_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(83094..84224)
Genome map
AA seq 376 aa AA seqDB search
MNLLEYEAKAIAKKYGIPTPEGVLIERPEQVNEAVEKLGLPVVLKAQVPVAGRGKAGGVK
LARDPDEALELAEELFSKEIKGFPVLSLLVEKAENIQKELYLSFTIDRTNRKVVMLASAE
GGMEIEELAKEKPDAIVKLPIEPEVGLKAHEAREVGKRIGLSGQLLRQFEGIAKTMYKIF
EDYDAELVESNPLAITDRGLVALDFRMIVDDNAIFRHPELEASRERELSELEKEAARWGF
FYVELDGDIGIIGNGAGLTMATMDVVNYYGGRPANFLDIGGGARRDRVKAAVNVLLKNPK
VKVIFVNIFGGITLASEVAQGIVDALSESNVKKPIVARIVGTAEEEGKKILKEAGIPLFE
SMDEAAQEAVKLAKAA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctcctcgagtacgaggcaaaggccatcgcgaagaaatatggcataccgacgccc
gaaggggtgctaatcgagaggccggaacaagtgaacgaagcagtggagaagctcggactg
ccggtggtcttgaaggcccaagtcccggtggcgggcagggggaaggccggaggggttaag
cttgcccgcgaccccgacgaggcgttagagctggcggaggagctcttctcaaaggaaata
aaggggttccccgtgctctcgttgctagtagaaaaggcggagaacatccaaaaagagttg
tacctctctttcacaatagacagaacaaaccgcaaggtagtaatgctggcctccgccgag
ggcgggatggagatagaggagctcgctaaagagaagcccgatgccatagtgaaactcccc
atagagcccgaggtaggcctcaaggcccacgaggcgagggaggtcgggaagaggataggc
ttgagcgggcaactgttaaggcagttcgaggggatagctaagactatgtacaagatcttc
gaagattacgacgcagagcttgtagagagcaacccgttagctataaccgacaggggcttg
gtggcgctagacttcaggatgatagttgacgacaacgcgatcttcagacacccggagctc
gaggcctctagggagagggagctgagcgagctggagaaggaggccgcccgctggggcttc
ttctacgtcgagctggacggcgacatagggatcataggcaacggggccggactcacgatg
gccactatggacgtcgtcaactattacggcggcaggcccgcgaacttcctcgacataggg
ggcggcgccaggagggacagagttaaagcagctgtgaacgtcctcctgaagaatccaaag
gtaaaggtaatattcgttaacatattcggagggataaccttggccagcgaggtggcccaa
ggaatagtggacgccctctccgagtccaacgtcaagaagcccatagtggcgaggatcgta
gggaccgcggaggaggagggcaagaaaatattgaaggaggccggcataccgctttttgag
agcatggacgaggccgcccaagaagcggtcaagctggccaaggccgcttaa

DBGET integrated database retrieval system