KEGG   Ignicoccus hospitalis: Igni_0086Help
Entry
Igni_0086         CDS       T00587                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00020  Citrate cycle (TCA cycle)
iho00640  Propanoate metabolism
iho00660  C5-Branched dibasic acid metabolism
iho00720  Carbon fixation pathways in prokaryotes
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01120  Microbial metabolism in diverse environments
iho01130  Biosynthesis of antibiotics
iho01200  Carbon metabolism
Module
iho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Igni_0086
   00640 Propanoate metabolism
    Igni_0086
   00660 C5-Branched dibasic acid metabolism
    Igni_0086
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_0086
Enzymes [BR:iho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Igni_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp RimK Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABU81270
JGI: Igni0086
UniProt: A8A8L8
Position
complement(83094..84224)
Genome map
AA seq 376 aa AA seqDB search
MNLLEYEAKAIAKKYGIPTPEGVLIERPEQVNEAVEKLGLPVVLKAQVPVAGRGKAGGVK
LARDPDEALELAEELFSKEIKGFPVLSLLVEKAENIQKELYLSFTIDRTNRKVVMLASAE
GGMEIEELAKEKPDAIVKLPIEPEVGLKAHEAREVGKRIGLSGQLLRQFEGIAKTMYKIF
EDYDAELVESNPLAITDRGLVALDFRMIVDDNAIFRHPELEASRERELSELEKEAARWGF
FYVELDGDIGIIGNGAGLTMATMDVVNYYGGRPANFLDIGGGARRDRVKAAVNVLLKNPK
VKVIFVNIFGGITLASEVAQGIVDALSESNVKKPIVARIVGTAEEEGKKILKEAGIPLFE
SMDEAAQEAVKLAKAA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctcctcgagtacgaggcaaaggccatcgcgaagaaatatggcataccgacgccc
gaaggggtgctaatcgagaggccggaacaagtgaacgaagcagtggagaagctcggactg
ccggtggtcttgaaggcccaagtcccggtggcgggcagggggaaggccggaggggttaag
cttgcccgcgaccccgacgaggcgttagagctggcggaggagctcttctcaaaggaaata
aaggggttccccgtgctctcgttgctagtagaaaaggcggagaacatccaaaaagagttg
tacctctctttcacaatagacagaacaaaccgcaaggtagtaatgctggcctccgccgag
ggcgggatggagatagaggagctcgctaaagagaagcccgatgccatagtgaaactcccc
atagagcccgaggtaggcctcaaggcccacgaggcgagggaggtcgggaagaggataggc
ttgagcgggcaactgttaaggcagttcgaggggatagctaagactatgtacaagatcttc
gaagattacgacgcagagcttgtagagagcaacccgttagctataaccgacaggggcttg
gtggcgctagacttcaggatgatagttgacgacaacgcgatcttcagacacccggagctc
gaggcctctagggagagggagctgagcgagctggagaaggaggccgcccgctggggcttc
ttctacgtcgagctggacggcgacatagggatcataggcaacggggccggactcacgatg
gccactatggacgtcgtcaactattacggcggcaggcccgcgaacttcctcgacataggg
ggcggcgccaggagggacagagttaaagcagctgtgaacgtcctcctgaagaatccaaag
gtaaaggtaatattcgttaacatattcggagggataaccttggccagcgaggtggcccaa
ggaatagtggacgccctctccgagtccaacgtcaagaagcccatagtggcgaggatcgta
gggaccgcggaggaggagggcaagaaaatattgaaggaggccggcataccgctttttgag
agcatggacgaggccgcccaagaagcggtcaagctggccaaggccgcttaa

DBGET integrated database retrieval system