KEGG   Ignicoccus hospitalis: Igni_0086Help
Entry
Igni_0086         CDS       T00587                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
iho  Ignicoccus hospitalis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_0086
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Igni_0086
   00640 Propanoate metabolism
    Igni_0086
   00660 C5-Branched dibasic acid metabolism
    Igni_0086
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_0086
Enzymes [BR:iho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Igni_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(83094..84224)
Genome map
AA seq 376 aa AA seqDB search
MNLLEYEAKAIAKKYGIPTPEGVLIERPEQVNEAVEKLGLPVVLKAQVPVAGRGKAGGVK
LARDPDEALELAEELFSKEIKGFPVLSLLVEKAENIQKELYLSFTIDRTNRKVVMLASAE
GGMEIEELAKEKPDAIVKLPIEPEVGLKAHEAREVGKRIGLSGQLLRQFEGIAKTMYKIF
EDYDAELVESNPLAITDRGLVALDFRMIVDDNAIFRHPELEASRERELSELEKEAARWGF
FYVELDGDIGIIGNGAGLTMATMDVVNYYGGRPANFLDIGGGARRDRVKAAVNVLLKNPK
VKVIFVNIFGGITLASEVAQGIVDALSESNVKKPIVARIVGTAEEEGKKILKEAGIPLFE
SMDEAAQEAVKLAKAA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctcctcgagtacgaggcaaaggccatcgcgaagaaatatggcataccgacgccc
gaaggggtgctaatcgagaggccggaacaagtgaacgaagcagtggagaagctcggactg
ccggtggtcttgaaggcccaagtcccggtggcgggcagggggaaggccggaggggttaag
cttgcccgcgaccccgacgaggcgttagagctggcggaggagctcttctcaaaggaaata
aaggggttccccgtgctctcgttgctagtagaaaaggcggagaacatccaaaaagagttg
tacctctctttcacaatagacagaacaaaccgcaaggtagtaatgctggcctccgccgag
ggcgggatggagatagaggagctcgctaaagagaagcccgatgccatagtgaaactcccc
atagagcccgaggtaggcctcaaggcccacgaggcgagggaggtcgggaagaggataggc
ttgagcgggcaactgttaaggcagttcgaggggatagctaagactatgtacaagatcttc
gaagattacgacgcagagcttgtagagagcaacccgttagctataaccgacaggggcttg
gtggcgctagacttcaggatgatagttgacgacaacgcgatcttcagacacccggagctc
gaggcctctagggagagggagctgagcgagctggagaaggaggccgcccgctggggcttc
ttctacgtcgagctggacggcgacatagggatcataggcaacggggccggactcacgatg
gccactatggacgtcgtcaactattacggcggcaggcccgcgaacttcctcgacataggg
ggcggcgccaggagggacagagttaaagcagctgtgaacgtcctcctgaagaatccaaag
gtaaaggtaatattcgttaacatattcggagggataaccttggccagcgaggtggcccaa
ggaatagtggacgccctctccgagtccaacgtcaagaagcccatagtggcgaggatcgta
gggaccgcggaggaggagggcaagaaaatattgaaggaggccggcataccgctttttgag
agcatggacgaggccgcccaagaagcggtcaagctggccaaggccgcttaa

DBGET integrated database retrieval system