KEGG   Ignicoccus hospitalis: Igni_0090Help
Entry
Igni_0090         CDS       T00587                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00860  Porphyrin and chlorophyll metabolism
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01120  Microbial metabolism in diverse environments
Module
iho_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Igni_0090
Enzymes [BR:iho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Igni_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 2-Hacid_dh SepF Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: ABU81274
JGI: Igni0090
UniProt: A8A8M2
Position
85828..86532
Genome map
AA seq 234 aa AA seqDB search
MLTLSPHGPPPFKDLEVTNVPALELVDVADASQIKEAIKEGEAVVFTSKTGVRLVFEKLG
DEALELLKGKDVVAIGPKTAAELEARGLSPIVPEEYHSGALAKLLKRYNKVVALRSDKAS
KTLKDELGDKLIEVVIYKTLRRPSPKIVEAAREADAVAVSSAEVARALIESFQKYSSIDE
LKKLKIAVIGPEAAKPLKELGLNFVVAPEATFEGLEEAVKRIIRGGPGESPEER
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgctcactctgagcccccacggacctccccccttcaaggacctcgaagtgaccaacgtc
ccggcgctagagctggtggacgtcgcggacgcctcccaaatcaaggaagccataaaggag
ggggaggcagtagtcttcacttccaagaccggcgtgaggttggtgttcgaaaagctcggg
gacgaggccctcgagttgctcaaggggaaggacgtggtggcaatagggcccaagacggcg
gccgagctcgaggcgaggggcttgagccccatagtgccggaggagtaccactccggcgcg
ctggcaaagctcttgaagcgttacaacaaggtagtggccctgaggtccgacaaggcgtca
aagactttgaaggatgagttaggagacaagctcatcgaggtggttatttataaaaccttg
aggaggccctctccaaagatagtggaggcggctagggaggccgacgcagttgccgtgagc
agcgccgaggtcgcccgggccttaatagagtcctttcagaagtactctagtattgacgaa
cttaagaagttgaaaatagccgtaatagggcccgaggcagcaaagccgttgaaggagttg
ggcttgaacttcgtggtcgccccggaagccacttttgaagggttggaggaggcagttaag
agaataatacggggaggaccgggagaaagccccgaggagcgctaa

DBGET integrated database retrieval system