KEGG   Ignicoccus hospitalis: Igni_0256Help
Entry
Igni_0256         CDS       T00587                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_0256
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_0256
   00620 Pyruvate metabolism
    Igni_0256
   00640 Propanoate metabolism
    Igni_0256
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_0256
   00680 Methane metabolism
    Igni_0256
Enzymes [BR:iho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Igni_0256
Lipid biosynthesis proteins [BR:iho01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Igni_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
221174..222412
Genome map
AA seq 412 aa AA seqDB search
MTEEQKTVLPISKGVVPTGKLHEMRKRALEDPEGFWSEIASELYWKKGWDKVVEGEAPYF
KWFVGGKTNISYNALDRHVKTWRRNKAAIIWEGEPGETRVMTYYQLWKEVNRFANVLKDL
GVKKGDRVTIYMPMVPEAVVAMLATVRVGAIHSVVFSGFSAKGLAERINDAQAKVVITAD
GMWRRGKKLILKEIVDKALEETPSVESVVVYKRLGEEVNMVEGRDYWWDDLMEGAEDYAE
PEWVESEHPSFILYTSGTTGKPKGIIHDTGGYMVGVYATMKWVFDIRDDDLHWCTADIGW
ITGHSYVVYGPLLHGATTLMYEGAPDYPKPDRWWSIIEKYGVTTFYTAPTAIRMFMRYGE
KWVEKHDLSTLRILGSVGEPINPEAWWWYFKHVGKGKCPIVDTWWQTETGHT
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaagaacagaagactgtgttaccgatcagtaagggcgtggtccctactggaaag
ctccacgagatgaggaagagggccctcgaggacccggagggcttctggtcggagatcgcc
tcggagctctattggaagaagggttgggataaggtagtcgagggcgaggccccctacttc
aagtggttcgtgggcgggaagaccaacatatcctacaacgccttagacaggcacgttaag
acttggaggaggaacaaggccgccataatctgggagggcgagcccggcgagaccagggtc
atgacttattaccagctctggaaggaagtaaaccgcttcgccaacgtgctgaaggatttg
ggcgttaagaagggagacagagtgaccatttacatgcccatggttcccgaggcagtcgtc
gctatgctggcgaccgtgagggtcggcgcgatccacagcgtggtcttctccgggttctct
gcgaaggggttggcggagaggataaacgacgctcaagctaaggtcgtgataacggccgac
ggcatgtggaggagggggaagaagctcatactcaaggaaatagtggacaaggctttggag
gagacgccgtccgtggagagcgtggtggtttacaagaggctgggcgaggaggtcaacatg
gtcgagggcagggactactggtgggacgacctcatggagggcgcggaggactacgcggag
cccgagtgggtggagagcgagcacccctccttcatcctctacacttccggcaccaccggc
aagcccaaggggataattcacgacaccgggggctacatggtaggagtctacgctacgatg
aagtgggtattcgacataagggacgacgacttgcactggtgtactgcagacataggctgg
atcaccggccactcctacgtggtctacggccccttgctccacggggccactaccctcatg
tacgagggcgcccccgactaccccaagcccgaccgctggtggagcataattgagaagtac
ggtgtaactaccttctacacggctcccacggctataaggatgttcatgaggtatggcgag
aagtgggtggagaagcacgacctcagcaccttgaggatcttgggcagcgtcggcgagccc
ataaacccggaggcgtggtggtggtacttcaagcacgtcggcaagggcaagtgtcccata
gtagacacttggtggcagacggagaccgggcacacatag

DBGET integrated database retrieval system