KEGG   Ignicoccus hospitalis: Igni_0256Help
Entry
Igni_0256         CDS       T00587                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00010  Glycolysis / Gluconeogenesis
iho00620  Pyruvate metabolism
iho00640  Propanoate metabolism
iho00680  Methane metabolism
iho00720  Carbon fixation pathways in prokaryotes
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01120  Microbial metabolism in diverse environments
iho01130  Biosynthesis of antibiotics
iho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_0256
   00620 Pyruvate metabolism
    Igni_0256
   00640 Propanoate metabolism
    Igni_0256
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_0256
   00680 Methane metabolism
    Igni_0256
Enzymes [BR:iho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Igni_0256
Lipid biosynthesis proteins [BR:iho01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Igni_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABU81440
JGI: Igni0256
UniProt: A8A938
Position
221174..222412
Genome map
AA seq 412 aa AA seqDB search
MTEEQKTVLPISKGVVPTGKLHEMRKRALEDPEGFWSEIASELYWKKGWDKVVEGEAPYF
KWFVGGKTNISYNALDRHVKTWRRNKAAIIWEGEPGETRVMTYYQLWKEVNRFANVLKDL
GVKKGDRVTIYMPMVPEAVVAMLATVRVGAIHSVVFSGFSAKGLAERINDAQAKVVITAD
GMWRRGKKLILKEIVDKALEETPSVESVVVYKRLGEEVNMVEGRDYWWDDLMEGAEDYAE
PEWVESEHPSFILYTSGTTGKPKGIIHDTGGYMVGVYATMKWVFDIRDDDLHWCTADIGW
ITGHSYVVYGPLLHGATTLMYEGAPDYPKPDRWWSIIEKYGVTTFYTAPTAIRMFMRYGE
KWVEKHDLSTLRILGSVGEPINPEAWWWYFKHVGKGKCPIVDTWWQTETGHT
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaagaacagaagactgtgttaccgatcagtaagggcgtggtccctactggaaag
ctccacgagatgaggaagagggccctcgaggacccggagggcttctggtcggagatcgcc
tcggagctctattggaagaagggttgggataaggtagtcgagggcgaggccccctacttc
aagtggttcgtgggcgggaagaccaacatatcctacaacgccttagacaggcacgttaag
acttggaggaggaacaaggccgccataatctgggagggcgagcccggcgagaccagggtc
atgacttattaccagctctggaaggaagtaaaccgcttcgccaacgtgctgaaggatttg
ggcgttaagaagggagacagagtgaccatttacatgcccatggttcccgaggcagtcgtc
gctatgctggcgaccgtgagggtcggcgcgatccacagcgtggtcttctccgggttctct
gcgaaggggttggcggagaggataaacgacgctcaagctaaggtcgtgataacggccgac
ggcatgtggaggagggggaagaagctcatactcaaggaaatagtggacaaggctttggag
gagacgccgtccgtggagagcgtggtggtttacaagaggctgggcgaggaggtcaacatg
gtcgagggcagggactactggtgggacgacctcatggagggcgcggaggactacgcggag
cccgagtgggtggagagcgagcacccctccttcatcctctacacttccggcaccaccggc
aagcccaaggggataattcacgacaccgggggctacatggtaggagtctacgctacgatg
aagtgggtattcgacataagggacgacgacttgcactggtgtactgcagacataggctgg
atcaccggccactcctacgtggtctacggccccttgctccacggggccactaccctcatg
tacgagggcgcccccgactaccccaagcccgaccgctggtggagcataattgagaagtac
ggtgtaactaccttctacacggctcccacggctataaggatgttcatgaggtatggcgag
aagtgggtggagaagcacgacctcagcaccttgaggatcttgggcagcgtcggcgagccc
ataaacccggaggcgtggtggtggtacttcaagcacgtcggcaagggcaagtgtcccata
gtagacacttggtggcagacggagaccgggcacacatag

DBGET integrated database retrieval system