KEGG   Ignicoccus hospitalis: Igni_0324Help
Entry
Igni_0324         CDS       T00587                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00860  Porphyrin and chlorophyll metabolism
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Igni_0324
Enzymes [BR:iho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Igni_0324
Exosome [BR:iho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Igni_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABU81507
JGI: Igni0324
UniProt: A8A9A5
Position
complement(280797..281825)
Genome map
AA seq 342 aa AA seqDB search
MSFPRLRPRRLRKNLYLRDLVAETRLSPRDFIYPIFVKEGIDKPEEISAMPGQMRWPVGE
ELVKHVQEALDLGVRSVLLFGVPKHKDDLGSSAYDDQGVVQRAVRLLKKELGDEVVVFTD
VCLCHYTSHGHCGVLAKRCRGDLCEYVVDNDKTLELLAKVALSHAKAGADVVAPSSMMDG
MVLAIREALDKEGFTDVAIMSYAAKYASAFYGPFREAASNAPQHGDRRTYQMDPRNGEEA
LKEVMLDVKEGADILMVKPALSYLDVIRRVREAFPHYPLAAYNVSGEYSMVKAAAEKGLV
DEKKITLEILHSIKRAGANIIITYHALEASRWLKEGLDLKMF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgagcttccccaggctccggccgcgcaggctgaggaagaacttgtacctcagggacttg
gtcgccgagaccaggctctcccccagggacttcatataccccatattcgtcaaagaaggc
atagacaagcctgaagagataagcgcgatgcccgggcagatgaggtggccggtgggagag
gagttagtgaagcacgtccaagaggcgttggacctaggggtaaggtcggtgctgctcttc
ggggtccccaagcacaaggacgacctcggctcctccgcttacgacgaccaaggggtggtc
cagagggcggtcaggctgctcaagaaggagctgggggacgaggtggtggtcttcacggac
gtgtgcctctgccactacacctcccacggccactgcggggtcctagccaagaggtgtcgc
ggcgacctctgcgagtacgtggtggacaacgacaagaccttggagctgttagctaaggtc
gccctctcccacgccaaggcgggggcggacgtggtggccccctcctcgatgatggacggc
atggtgctggccataagggaggccttggacaaggagggcttcacggacgtggctataatg
agctacgccgccaagtacgcttccgccttctacggccccttccgcgaggccgccagcaac
gccccccagcacggggacaggaggacctaccagatggaccccaggaacggggaggaggcc
ttgaaggaggttatgttggacgttaaggagggggcggacatcttgatggtgaagcccgcg
ctctcctacttggacgttataaggagggtgagggaggccttcccccactaccccttagca
gcatacaacgtcagcggagagtacagcatggttaaggcggcggccgagaaggggctggtg
gacgagaagaagataactttggaaatactgcactcaataaagagggccggcgcaaacata
ataataacgtaccacgccttggaggcctcgaggtggctcaaggaagggttggacctaaag
atgttctag

DBGET integrated database retrieval system