KEGG   Ignicoccus hospitalis: Igni_0363Help
Entry
Igni_0363         CDS       T00587                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_0363
   01230 Biosynthesis of amino acids
    Igni_0363
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_0363
   00030 Pentose phosphate pathway
    Igni_0363
   00051 Fructose and mannose metabolism
    Igni_0363
  Energy metabolism
   00680 Methane metabolism
    Igni_0363
Enzymes [BR:iho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Igni_0363
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Igni_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(317110..318273)
Genome map
AA seq 387 aa AA seqDB search
MAQKTTISVIKADIGSLAGHHTVHPDCMAAASRVLAEAKKNGVINDFYVTHVGDDLILIM
THTKGVDHPDVHGLAWEAFKKAAEVAKELGLYAAGQDLLSDAFSGNVRGLGPAAAEMEIE
ERPSEPIVIFAADKTEPGAFNLPLYKIFADPFNTAGLVIDPRLHDGFVFEVVDVFEDKGV
HLNTPEELYDLLALIGTPSRYVIRRVFRKDGKIAAVVSVERLNLIAGKYVGKDDPVMIVR
AQSGFPAVGEVLEPFTFPHLVAGWMRGSHNGPLMPVPVRDARPTRFDGPPRVIALGFQVK
NAKLVGPSDLFDDPAFDEARRTANKVADYIRRHGPFMPHRLDPSEMEYTTLPQVLERLKD
RFKPVKDLPVPKVKHSEMLSGAEEAHD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggcccagaagacgaccataagcgtgattaaagccgatatcggctccttggctggccac
cacaccgtccacccggactgcatggcggcggcttccagagtcctcgccgaagcgaagaag
aacggcgtcataaacgacttctacgtaacccacgtgggcgacgacctcatcctaataatg
acccacaccaaaggcgtggaccacccggacgtacacggtttggcttgggaggccttcaag
aaggccgcggaagtggctaaggagctcggcctctacgcggccgggcaagacttgctcagc
gacgcgttctccggcaacgtgaggggcctgggccccgcggcggccgagatggagatagag
gagaggccgagcgaacccatagtgatattcgccgcagacaagaccgagcctggggccttc
aacctacccttgtacaagatcttcgcagaccccttcaacaccgccggcctggtcattgac
ccgaggctccacgacggcttcgtgttcgaggtagtggacgtcttcgaggacaagggagtc
cacttgaacacccccgaagagctttacgacttgctggccctcataggcaccccctcgagg
tacgtgataaggagggtgttccgcaaggacggcaagatagcggcagtggtcagcgtcgag
aggctgaacttgatagccggcaagtacgtgggcaaggacgacccggtaatgatagttagg
gcccagagcggcttccccgccgtgggcgaggtgctggagcccttcaccttcccccacttg
gtggcgggctggatgaggggctcccacaacggccccttgatgcccgtccccgtgagggac
gccaggcccaccaggttcgacgggcccccgagagtgatagcgctgggcttccaagtgaag
aacgccaagctcgtaggccccagcgacctcttcgacgaccccgccttcgacgaggcgagg
aggaccgcgaacaaggtggcggactacataaggaggcacggcccgttcatgccgcacagg
ctggaccccagcgagatggagtacaccaccttgcctcaagtgctagagaggctcaaggac
aggttcaagcccgtcaaggacttgcccgtcccgaaggtaaagcactccgaaatgttgagt
ggggccgaagaagcgcacgactaa

DBGET integrated database retrieval system