KEGG   Ignicoccus hospitalis: Igni_0431Help
Entry
Igni_0431         CDS       T00587                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igni_0431
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igni_0431
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igni_0431
Enzymes [BR:iho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Igni_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(383194..383946)
Genome map
AA seq 250 aa AA seqDB search
MKVDPSKRPWLVAYLTLNYPDERTFLKALEYLKDKAELVEIGIPPKFAKYDGPTIRRSYK
AVSSKGLGLHNFEGELRKACRAFPEERIIVMTYYDDVKENYEEFLDKACGGGVLFADAVI
DFADRLEEIASKAKERGKSAVFFVSPTTPDHVIRKAAELSDPVVYLGVRPATGIPLPVGI
PNLLRRVKSLTNKYVVVGFGLKEEEVPQAVGAGADGVVVGSALVKALGEGFDNFKKVVDR
YLALLSLPKR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtggacccctccaagaggccttggctggtggcctacctaaccttgaactacccc
gacgaacggaccttcctcaaggccttggagtacttgaaggataaggcggagctcgtggag
ataggcatacccccgaagttcgccaagtacgacgggcccacaataaggaggagctacaag
gcggtctcctccaagggcttgggcttacacaacttcgagggggagctgcgcaaggcttgt
cgcgccttcccggaagaaagaataattgtgatgacatattatgacgacgttaaggagaac
tacgaagagttcttggataaggcgtgcggagggggagtgctcttcgcggacgccgtcata
gacttcgcggaccgcttggaggagatcgcgagtaaggcgaaggagcgcggcaagagcgcg
gtgttcttcgtctcccccaccacccccgaccacgtgataaggaaggccgcggagctgagc
gacccggtggtttacctaggcgtcaggccggccaccgggatccccctgcccgtagggata
ccgaacttgctgaggagggtgaagtctttgaccaacaagtacgtggtagtgggcttcggc
ttgaaggaagaggaggtcccccaagcggtgggagcgggggcggacggggtagtggtgggg
agcgctttggttaaggccttaggggagggcttcgataacttcaaaaaggtggtggatagg
tacttggccctcctcagcctccccaagagatga

DBGET integrated database retrieval system