KEGG   Ignicoccus hospitalis: Igni_0475Help
Entry
Igni_0475         CDS       T00587                                 

Definition
coenzyme F390 synthetase-like protein
Orthology
K14466  
4-hydroxybutyrate---CoA ligase (AMP-forming) [EC:6.2.1.40]
Organism
iho  Ignicoccus hospitalis
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_0475
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_0475
Enzymes [BR:iho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.40  4-hydroxybutyrate---CoA ligase
     Igni_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
421334..422815
Genome map
AA seq 493 aa AA seqDB search
MLSGRAVVFERYSRATPLGAYLEEGRRFREEGFIRTDYPPKRDEVLWNPKIMRMPREELE
KIKTQRLKAIVKWAWEHSEFYRKFWKSKGFHPDMIKTHEDVVKIPVLTKKDLRADLQKNP
PYGTIMVPELAKYIHFVGATSGSTGMPTFQGWGRVELDYFEEQQARYLWTFAGVKPGVVY
ANYLNMSGFYSWGPPLVETAMWRCGATAIAGGGETFFTWKDRHMLIMKLWKVDVFATTPW
LHRWIGEQAKLEGWVTPFKVLLLHGGAAAEKTKEKLMEVHPNVEKVISVWGTTDGHMAIE
PPDAPGTLVFWEDTQIFDIVVPGSYEERPEGEPAGQGERGELIATLLTHYTMPLIRYSLG
DYVKNEFICDPTPELGITHCRFAELIPGRVEWMFKVKGKLLFPIVVENAVSQIPDTTGAY
NIVVYDDNMDKLKIKVETRKPIPPPPEYDKEAREIIARELGLSPEDVEIEWIRPGESVWK
GYKLQVFLDERKK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcttagcggtagagcagtcgtgttcgagcgctactcgagggccacccccctcggggcg
tacttggaggaagggcggaggttcagggaagagggcttcataaggacggactacccccct
aagagggacgaggtcctctggaaccccaaaattatgaggatgcccagggaagagctggag
aagataaagacccagaggctcaaggccatagttaagtgggcgtgggagcacagcgagttc
taccgcaagttctggaagagcaagggcttccacccggacatgataaagactcacgaggac
gtggtcaagataccggtcctcaccaagaaggacttgagagcggacttgcagaagaacccg
ccttacggcaccataatggttccggaactggccaagtacatacacttcgtgggcgccacc
tccggcagcaccgggatgcccaccttccaaggctggggcagggtggagctggactacttc
gaggaacagcaagctaggtacttgtggaccttcgccggcgtcaagcccggcgtagtctat
gcgaactacctcaacatgagcggcttctacagctggggcccgcccctcgtggagaccgcc
atgtggaggtgcggcgccaccgccatcgccggcgggggcgagaccttcttcacttggaag
gacaggcacatgctaataatgaagctgtggaaggttgacgtcttcgccaccaccccgtgg
ctccaccgctggataggcgagcaagccaagctggagggctgggtgaccccgttcaaggtg
ctcttgctccacggaggggcagcggccgagaagaccaaggagaagctgatggaggtccac
cccaacgtcgagaaggtcataagcgtctggggcactacggacggtcacatggcaatcgag
ccccccgacgcgcccgggaccttggtgttctgggaggacacccagatcttcgacatagtg
gtgcccggcagctacgaggagaggcccgagggcgagccggcgggccagggcgagagggga
gagctcatagccaccttgctgacccactacaccatgcccttgataaggtacagcctgggc
gactacgtgaagaacgagttcatatgcgaccccaccccggagctgggcataacccactgt
aggttcgccgagctcataccgggcagagtggagtggatgttcaaggtaaagggcaagctg
ctcttccccatagtggtcgagaacgcggtgagccagataccggacaccaccggcgcctac
aacatagtagtttacgacgacaacatggacaagctgaagataaaggtggagaccaggaag
cccataccgccccctccggagtacgacaaggaggcaagggagatcatagcgagggagctc
ggcctgagcccggaggacgtggagatagagtggataaggcccggcgagagcgtctggaag
ggctacaagctgcaagtgttcttggacgagaggaagaagtaa

DBGET integrated database retrieval system