KEGG   Ignicoccus hospitalis: Igni_0475Help
Entry
Igni_0475         CDS       T00587                                 

Definition
coenzyme F390 synthetase-like protein
Orthology
K14466  
4-hydroxybutyryl-CoA synthetase (4-hydroxybutyrate-CoA ligase, AMP-forming) [EC:6.2.1.-]
Organism
iho  Ignicoccus hospitalis
Pathway
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:iho01200]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
421334..422815
Genome map
AA seq 493 aa AA seqDB search
MLSGRAVVFERYSRATPLGAYLEEGRRFREEGFIRTDYPPKRDEVLWNPKIMRMPREELE
KIKTQRLKAIVKWAWEHSEFYRKFWKSKGFHPDMIKTHEDVVKIPVLTKKDLRADLQKNP
PYGTIMVPELAKYIHFVGATSGSTGMPTFQGWGRVELDYFEEQQARYLWTFAGVKPGVVY
ANYLNMSGFYSWGPPLVETAMWRCGATAIAGGGETFFTWKDRHMLIMKLWKVDVFATTPW
LHRWIGEQAKLEGWVTPFKVLLLHGGAAAEKTKEKLMEVHPNVEKVISVWGTTDGHMAIE
PPDAPGTLVFWEDTQIFDIVVPGSYEERPEGEPAGQGERGELIATLLTHYTMPLIRYSLG
DYVKNEFICDPTPELGITHCRFAELIPGRVEWMFKVKGKLLFPIVVENAVSQIPDTTGAY
NIVVYDDNMDKLKIKVETRKPIPPPPEYDKEAREIIARELGLSPEDVEIEWIRPGESVWK
GYKLQVFLDERKK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcttagcggtagagcagtcgtgttcgagcgctactcgagggccacccccctcggggcg
tacttggaggaagggcggaggttcagggaagagggcttcataaggacggactacccccct
aagagggacgaggtcctctggaaccccaaaattatgaggatgcccagggaagagctggag
aagataaagacccagaggctcaaggccatagttaagtgggcgtgggagcacagcgagttc
taccgcaagttctggaagagcaagggcttccacccggacatgataaagactcacgaggac
gtggtcaagataccggtcctcaccaagaaggacttgagagcggacttgcagaagaacccg
ccttacggcaccataatggttccggaactggccaagtacatacacttcgtgggcgccacc
tccggcagcaccgggatgcccaccttccaaggctggggcagggtggagctggactacttc
gaggaacagcaagctaggtacttgtggaccttcgccggcgtcaagcccggcgtagtctat
gcgaactacctcaacatgagcggcttctacagctggggcccgcccctcgtggagaccgcc
atgtggaggtgcggcgccaccgccatcgccggcgggggcgagaccttcttcacttggaag
gacaggcacatgctaataatgaagctgtggaaggttgacgtcttcgccaccaccccgtgg
ctccaccgctggataggcgagcaagccaagctggagggctgggtgaccccgttcaaggtg
ctcttgctccacggaggggcagcggccgagaagaccaaggagaagctgatggaggtccac
cccaacgtcgagaaggtcataagcgtctggggcactacggacggtcacatggcaatcgag
ccccccgacgcgcccgggaccttggtgttctgggaggacacccagatcttcgacatagtg
gtgcccggcagctacgaggagaggcccgagggcgagccggcgggccagggcgagagggga
gagctcatagccaccttgctgacccactacaccatgcccttgataaggtacagcctgggc
gactacgtgaagaacgagttcatatgcgaccccaccccggagctgggcataacccactgt
aggttcgccgagctcataccgggcagagtggagtggatgttcaaggtaaagggcaagctg
ctcttccccatagtggtcgagaacgcggtgagccagataccggacaccaccggcgcctac
aacatagtagtttacgacgacaacatggacaagctgaagataaaggtggagaccaggaag
cccataccgccccctccggagtacgacaaggaggcaagggagatcatagcgagggagctc
ggcctgagcccggaggacgtggagatagagtggataaggcccggcgagagcgtctggaag
ggctacaagctgcaagtgttcttggacgagaggaagaagtaa

DBGET integrated database retrieval system