KEGG   Ignicoccus hospitalis: Igni_0570Help
Entry
Igni_0570         CDS       T00587                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00250  Alanine, aspartate and glutamate metabolism
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Igni_0570
Enzymes [BR:iho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Igni_0570
Peptidases [BR:iho01002]
 Cysteine Peptidases
  Family C44
   Igni_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ABU81752
JGI: Igni0570
UniProt: A8AA00
Position
complement(514046..515878)
Genome map
AA seq 610 aa AA seqDB search
MCGIVAVSCARPCVEERRLVSALDAIEHRGPDGRGYWISEDRKTALGNVRLAIIDPKDEG
LQPMFNEDGSVGVVLNGEIYNYKEIRQNLKDEHEFLSNTDTEVLLHAYEEMGVDVVHSLR
GMFAFAIYDERKGTIFVARDHVGKKPLFYYQGEDFVVLASEPSAIKAFVKNLSKNPLGAF
YLFAHFSPLPEQHFFENVKLLRNGEYMIIKDGKVIEKKKYYTLKFDKRVSDITSYVKELH
RELIRAVEYRLIADVPVSLALSSGVDSTLLASIITKELNRNDVSTFTVTVKGAGEFDEVE
LASKVAEELNLDHAVVEFDFEDYIKLTYELTKKVGLPITDPSLVMGYGMAKAARERGYKV
IIVGEGGDELFFGYPVYKQIYELTLTLSSLPLLELPFWVVKEVRSYYNKALCYATLHKLV
TARGLSLRSQCCEAFPPELCDLLVLSYRVLESLSAPRNLAERLLSYEYNQRIPNHLNLKV
DFYSMAASVEARAPLLDYKLIEKAMSLDPAWKRYIMMKEPKLIGKLILKKYLSEETWRKV
TSRKVGFGQQAKDVLMRIAEEEAPSRLKSSEILKKVIDPNIFERYDTKRLSFVAWQVFSY
SVWEEVIATW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgggatcgtagcggtgagctgcgctaggccgtgcgtggaggagcgccgactcgtc
tctgctctggacgcaatagaacacagggggccggacgggagggggtattggatatctgag
gaccgcaagaccgcgctgggcaacgtcaggctagccataatagaccctaaggacgagggc
ctccaacccatgttcaacgaggacggttccgtgggagtagtgttgaacggtgagatatac
aattataaagaaatccgccagaacttgaaggacgaacacgagttcttgtccaacacggac
accgaggtcttgttgcacgcgtacgaggagatgggagtggacgtggttcactccttaagg
gggatgttcgcgttcgcgatatacgacgaaaggaagggcacaatattcgttgccagggac
cacgtgggcaagaagcctttattctattaccaaggtgaggacttcgtcgttctcgcctca
gagccttcagcgattaaggcgttcgtgaagaacttgagcaagaaccccttgggagccttc
tacctcttcgcgcacttctcccccctcccggaacagcacttcttcgaaaacgtcaagttg
cttaggaacggagaatatatgataataaaagacgggaaggttatagaaaagaagaagtac
tacaccttgaagttcgataaaagggtgagtgatataacgagctacgtgaaggagctccat
cgagagctgataagggcggtggagtataggttaatagcggacgtgccggtctccttggcc
ttgagctccggcgtggactctacgttgctagcctcaataataacgaaggaactcaacagg
aacgacgttagcaccttcaccgtgactgttaagggcgccggggagttcgacgaagtggag
ttggcctctaaagttgctgaggagctaaacctcgaccacgcagtggtcgaattcgacttt
gaggattacataaagctcacttacgagctgaccaaaaaggtcgggctgcccataactgac
cccagcttggtgatggggtacgggatggctaaggcggcgagggaaaggggctacaaggta
atcatcgtcggggagggaggggacgagctcttcttcggctaccccgtgtataaacaaata
tacgagctcaccttaaccctctcctccctccccttgctcgagctccccttctgggtcgtg
aaggaagttagaagttactacaacaaggccttgtgttacgccaccctacacaagctcgtg
accgccagggggctctccttgaggtcccagtgctgcgaggccttccccccggagctctgc
gacctcttagtgttaagctaccgggttctggagtccctctccgcccctaggaacctcgcc
gagaggctcctctcgtacgagtacaaccagaggatacccaaccacttgaacttgaaggta
gacttctactctatggctgcgagcgtggaagccagggcgccgctattggactacaagtta
atagaaaaagctatgagcttagacccagcttggaagagatacataatgatgaaagagcca
aagctcattgggaagttgatattaaagaaatacttgagtgaggagacttggagaaaggtc
acatctaggaaggtcggcttcggacagcaagctaaggacgtcctaatgaggatagccgag
gaggaggcaccctcaaggctcaagagcagcgagatattaaaaaaggtcatagacccgaac
atatttgagaggtacgatacgaagaggttgtcattcgtagcgtggcaagtgttctcctac
agcgtttgggaggaggtgatcgctacttggtaa

DBGET integrated database retrieval system