KEGG   Ignicoccus hospitalis: Igni_0632Help
Entry
Igni_0632         CDS       T00587                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
iho  Ignicoccus hospitalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Igni_0632
Enzymes [BR:iho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Igni_0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
568762..569322
Genome map
AA seq 186 aa AA seqDB search
MEENVLEVAIKKFLEEMGEDPSRPGLSETPERYVRALRELFKGLETPKPELKTFKTEYLL
GENDLIVVKNVSFSSLCEHHLLPILGRASIVYHPKRDEVIGLSKIPRIVKWLAKRPMLQE
RFTAMIADEIMKAGARGVYVLVRAKHSCVAVRGVEDPDVEMITEAVRGTLEANPSLLERA
RKLVLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaacgtcttggaggttgctatcaaaaagttcttagaagaaatgggcgaagac
cccagcaggccgggcttgagcgaaacccccgagaggtacgtgagggctcttagagagctc
ttcaaaggcttggagacccccaagcctgagctgaagaccttcaagaccgagtacctcctc
ggggagaacgacctaatagtagtcaagaacgtgtctttcagctccttgtgcgaacatcac
ttgctgcccatactgggcagagcttccatcgtgtaccaccccaagagggacgaggtgatc
ggtttgagcaagataccgaggatagtgaagtggttagccaagaggcctatgttgcaagag
aggttcacggccatgattgccgacgagataatgaaggccggcgcgaggggcgtttacgtc
ctagttagggcgaagcactcttgcgtagcggttaggggggtggaggacccggacgtggaa
atgattacggaggcggtgaggggcactttggaggcgaacccgagcttgttagaaagggca
agaaaacttgtgttagactaa

DBGET integrated database retrieval system