KEGG   Ignicoccus hospitalis: Igni_0696Help
Entry
Igni_0696         CDS       T00587                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_0696
   01230 Biosynthesis of amino acids
    Igni_0696
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_0696
   00051 Fructose and mannose metabolism
    Igni_0696
   00562 Inositol phosphate metabolism
    Igni_0696
Enzymes [BR:iho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Igni_0696
Exosome [BR:iho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Igni_0696
  Exosomal proteins of bladder cancer cells
   Igni_0696
  Exosomal proteins of melanoma cells
   Igni_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(629160..629828)
Genome map
AA seq 222 aa AA seqDB search
MILAVNAKVYYPYSFGARLLRLARAIDKVAKEYSITTIIAPPHTELKEVKDIVEVTKVYA
QHLDPVEPGAHTGSVILEGIKEIIDGSIINHSEKRMRLDEIELVVSKLRRAGKESLVCAP
TPNTAAAVAALRPSMIAMEPPELIGTGVSVSRARPETVVETVRAVKGTGFAGPVLVGAGI
SSGEDVRKAIELGADGVLVASAVVKADDPYVKLKEFAEAMVR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatactggccgtcaacgcgaaggtatattacccatattccttcggcgcacgtctactg
aggttagctagggctatagacaaggtagccaaggaatactcgattactacgataatagcg
ccccctcatacagagctgaaggaagtgaaggacattgttgaagttactaaggtatacgct
caacacctagacccagtggagcctggggcccacacgggttccgtcatattagagggcata
aaggagataatagatggaagcataattaatcacagcgagaagaggatgaggcttgacgag
atagagctcgtggtctctaagttaaggcgtgcgggaaaagagagcttggtgtgcgccccc
acccctaacactgcggccgcggtcgccgccctgaggccttcaatgatagcgatggagcct
ccggaactgataggcaccggggtctcggtctcgcgcgcgaggccggagacggtggtggag
acggtaagagccgttaaggggaccggcttcgcgggcccggtcctagtgggggccgggatc
tccagcggcgaggacgtcagaaaggccatcgagctaggtgctgatggagtcttggtcgct
tcagccgtagtgaaggctgacgatccatacgtaaaacttaaggagttcgcggaggcaatg
gtaagatga

DBGET integrated database retrieval system