KEGG   Ignicoccus hospitalis: Igni_0696Help
Entry
Igni_0696         CDS       T00587                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_0696
   01230 Biosynthesis of amino acids
    Igni_0696
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_0696
   00051 Fructose and mannose metabolism
    Igni_0696
   00562 Inositol phosphate metabolism
    Igni_0696
Enzymes [BR:iho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Igni_0696
Exosome [BR:iho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Igni_0696
  Exosomal proteins of bladder cancer cells
   Igni_0696
  Exosomal proteins of melanoma cells
   Igni_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(629160..629828)
Genome map
AA seq 222 aa AA seqDB search
MILAVNAKVYYPYSFGARLLRLARAIDKVAKEYSITTIIAPPHTELKEVKDIVEVTKVYA
QHLDPVEPGAHTGSVILEGIKEIIDGSIINHSEKRMRLDEIELVVSKLRRAGKESLVCAP
TPNTAAAVAALRPSMIAMEPPELIGTGVSVSRARPETVVETVRAVKGTGFAGPVLVGAGI
SSGEDVRKAIELGADGVLVASAVVKADDPYVKLKEFAEAMVR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatactggccgtcaacgcgaaggtatattacccatattccttcggcgcacgtctactg
aggttagctagggctatagacaaggtagccaaggaatactcgattactacgataatagcg
ccccctcatacagagctgaaggaagtgaaggacattgttgaagttactaaggtatacgct
caacacctagacccagtggagcctggggcccacacgggttccgtcatattagagggcata
aaggagataatagatggaagcataattaatcacagcgagaagaggatgaggcttgacgag
atagagctcgtggtctctaagttaaggcgtgcgggaaaagagagcttggtgtgcgccccc
acccctaacactgcggccgcggtcgccgccctgaggccttcaatgatagcgatggagcct
ccggaactgataggcaccggggtctcggtctcgcgcgcgaggccggagacggtggtggag
acggtaagagccgttaaggggaccggcttcgcgggcccggtcctagtgggggccgggatc
tccagcggcgaggacgtcagaaaggccatcgagctaggtgctgatggagtcttggtcgct
tcagccgtagtgaaggctgacgatccatacgtaaaacttaaggagttcgcggaggcaatg
gtaagatga

DBGET integrated database retrieval system