KEGG   Ignicoccus hospitalis: Igni_1001Help
Entry
Igni_1001         CDS       T00587                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:iho01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:iho01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:iho00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
890769..891827
Genome map
AA seq 352 aa AA seqDB search
MSVKVAVNGFGTIGKRVAEAVLKQDDMTLVGVTKTKPDYLAMIASRMGSLYVPEDRVEKF
QKAGIEVQGTLKDLLEKVDLVVDATPGGVGKEYKPLYEKFGVKAIFQGGEKHEVAGFSFS
TLCNYEEAEGKQFARVVSCNTTGLLRLICALRNHFKVKSVRATIIRRGADPAETKKGPIN
AIVPNPVTLPSHHGVDVRTVLPDLDVQTVAAVVPTTIMHSHVLNVRFEEPVTREDVLKVL
EEAPRILVIPSELSGVKDTAKIIELARDVGRKRYDLYELAIYEESVSVEGDELFLMQAVH
QESIVTPENVDAIRALTGLVSKEESLKKTDSTLGIVRSFSELIERAASNYGK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgttaaggtcgcagtcaacggcttcggtactataggcaagagggtagctgaggcc
gtactaaaacaagacgacatgaccctcgtgggggtcacgaagaccaagccggattacttg
gcaatgatagcctcccgcatgggctcgctctatgtgcccgaagacagggtagagaagttc
cagaaggctggaatagaggtacaaggaaccttgaaggacttgctcgagaaggtcgacctc
gtcgtcgacgccaccccagggggcgtgggtaaggagtacaagcccctctacgagaagttc
ggagtgaaagccatattccaaggcggtgagaaacacgaggtcgcgggcttctcgttctcg
acgctgtgcaactacgaggaggcggaggggaagcagttcgccagggtggtgtcttgtaac
accaccggcctgttgaggctcatatgcgcgttaagaaaccacttcaaagtgaagagcgtc
agggcgaccataattaggaggggggccgatccggcggagactaagaagggacccataaac
gccatagtccccaacccggttaccttgcccagccaccacggcgtggacgtcagaacggtc
ttgccggacttggacgtccagacggtcgccgcggtggtgccgactacgataatgcactcg
cacgtactgaacgtgaggttcgaggagcccgtgaccagagaggacgtcttgaaggttctt
gaagaagctcccaggatactggtaatcccctccgaactgagcggggtgaaggacaccgct
aagataatcgaactcgccagggacgtcgggaggaagaggtacgacttatacgagctggcg
atatacgaggagagcgtgagcgtggagggcgacgagctgttcctcatgcaagccgtccac
caagaaagcatagtcaccccggagaacgtagatgcaattagggccctcacgggcttggtc
agcaaggaagagagcctgaagaagaccgactccaccttaggtatagtcagatccttctcg
gagctgatagaacgtgcggcttccaactacggtaagtaa

DBGET integrated database retrieval system