KEGG   Ignicoccus hospitalis: Igni_1034Help
Entry
Igni_1034         CDS       T00587                                 

Definition
(RefSeq) L-threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igni_1034
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igni_1034
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Igni_1034
Enzymes [BR:iho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Igni_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
922896..924122
Genome map
AA seq 408 aa AA seqDB search
MRAKLRCVRCGAEYDVQPKMFSCPKCGGLLEVVIEPEELPPFSEFTKRSRMKGIWRFAEL
LPVKSGSPVTMGEGNTPLIRLEKLEKVIGVRRLYAKFEGANPTGSFKDRGMSLAVTVAKE
VKARAVVAASTGNTAASAAAYSARAGLKTFLILPSGKVALGKLAQSLLHGAVVVELEGNF
DAALEAVKELAKMPEFYPLNSFNPWRLEGQKTLAFELFEEIGVPDVVVVPVGNAGNISAI
WKGFKELKEFGYSEALPKMVGVQAEGASPIASAFKAGLNAPLFTDSPETVATAIRIGKPV
NWMKAWKAVTESGGTFEVVSDSEIIRAQRLLAREEGVAAEPAGAASLAGVVRLASEGYFN
GDEVVTVVVTGHGLKDPDSVKFHPANKLTALNVEDAVEKVVSALKVVA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggccaagcttcgctgcgtccggtgcggggccgagtacgacgtacagcccaagatg
ttctcgtgccccaagtgcgggggcttgctggaggtggtaatagagccggaggagctgccc
cccttctctgagttcaccaagaggagcaggatgaaggggatatggcggttcgcggagctc
ctcccggtcaagagcggttccccagtaacgatgggcgagggcaatacccccctcataagg
ttggagaagctggagaaggtgataggcgtaaggaggctgtacgcgaagttcgaaggggcc
aaccctacgggctcctttaaggacaggggcatgagcctggcggtgaccgtagccaaggag
gttaaggccagagcggttgtggcagcctccactggcaacacggctgcttccgctgccgcc
tactcggccagggcggggctcaagacgttcttgatactcccgagcggcaaggtggccttg
ggcaagctggcccagagcttgttgcacggggcggtggtggtcgagctggaggggaacttc
gacgcggccttggaggcggtcaaggagctggccaagatgccggagttttacccgttgaac
tccttcaacccttggaggctcgagggtcagaagaccttggccttcgagctgttcgaagaa
ataggggtcccggacgtggtcgtggtgcccgtgggcaacgcgggcaacatatccgccata
tggaagggattcaaggagttgaaggagttcggctactccgaggccttgcccaagatggtc
ggggtccaagcggagggggcctcgcccatagcctccgccttcaaggccgggctgaacgcc
ccgctcttcaccgactcgcccgagaccgtggccactgcaataaggatagggaagcccgtg
aactggatgaaggcttggaaggccgtgacggagtccgggggaaccttcgaggtagtttcg
gactctgaaatcataagggcccaaaggctcctcgcgagggaggagggcgtggcggccgag
ccggcgggcgcggcgagcttggccggggtggtgaggctggcctctgagggctacttcaac
ggggacgaagtggtaaccgtggtggtcacgggccacgggctgaaggacccggacagcgtg
aagttccaccccgcgaacaagctgacggccttgaacgtagaggacgcggtggagaaggtc
gtaagcgcgttgaaggtggtcgcttga

DBGET integrated database retrieval system