KEGG   Ignicoccus hospitalis: Igni_1100Help
Entry
Igni_1100         CDS       T00587                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igni_1100
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igni_1100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igni_1100
Enzymes [BR:iho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Igni_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
980808..982088
Genome map
AA seq 426 aa AA seqDB search
MELPNKWYNILPDLPKPLAPPRDPEGAEEEFSRIELLLKVLPQKLIWQENTVERWVPIPD
EVLEVYKEIGRPTPLMRARRLEKLLDTPARIYFKYEGATPTGSHKINTAVPQAYYAKEEG
VEGLTTETGAGQWGTALALAGAMYDMPVKVFMVRSSYHQKPYRRVIMRLYGADVTPSPSE
ETEFGKKVLRENPDHPGSLGIAMSEAIEYALKRNWRYGVGSVMNFVLLHQSIIGLEAMKQ
MEEIGEDPDVLVACIGGGSNFGGLVFPFLGQELQKTKDPKKKRRRYVGVTPSEVPKFSKG
KYEYDFADAAGLLPQLKMHTLGHEFTPPPIYAGGLRYHGVAPAISLLYEEGWIEIMEYEQ
KECFEAGRLFAKAEGIVPAPETNHAIKAVIDLALEAKRKNEEMVILFNFSGHGLLDLGNY
QSVLGL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttccgaacaaatggtataacatactccccgacctccccaagcccttggcccct
ccgagagaccccgagggggcggaggaggagttctcgaggatagagctgttgctaaaggtg
ttgccacaaaagctcatctggcaagagaacaccgtggagcgctgggtccccataccggac
gaggtgttggaggtttacaaggaaatagggaggcccacccccctcatgagggcgaggagg
ctggagaagctcctagacaccccggcccgcatttacttcaagtacgagggcgccaccccc
accggcagccacaagataaacactgccgtcccacaagcctactacgctaaggaggaggga
gtggagggcctcaccaccgagaccggggccggccagtggggcacggccttggccttggcc
ggcgcgatgtacgacatgccggtcaaggtgtttatggtgaggagcagctaccaccagaag
ccctaccgcagagtaataatgaggctctacggcgccgacgtcaccccctcgcccagcgag
gagaccgagttcgggaagaaggtgttgagggagaaccccgaccaccccggaagcttgggg
atcgccatgagcgaggccatagaatacgctttgaagaggaactggaggtacggcgtcggg
tcagtaatgaacttcgtgctcctacaccaatcgatcataggcctcgaggccatgaagcag
atggaggagatcggcgaggacccggacgtgttagtggcttgcataggcgggggctctaac
ttcgggggcttggtgttccccttcttggggcaagagctccagaagaccaaggaccccaag
aagaagaggaggaggtacgtgggagttaccccctctgaggtgcccaagttcagcaagggc
aagtacgagtacgacttcgccgacgcggccggcctcctcccgcagctcaagatgcacacc
ttaggccacgagttcaccccgccccccatatacgcggggggactgaggtaccacggggtg
gccccggccatatccttgctctacgaggaagggtggatcgaaattatggagtacgaacag
aaggagtgcttcgaggccggcaggctcttcgccaaggccgagggaattgtgccggcgccg
gagacaaaccacgcgatcaaggcggttatagaccttgctttggaagctaagaggaagaac
gaagagatggtaatactcttcaacttcagtggccacgggttgttagacctgggcaactac
cagagcgtcttgggcttgtga

DBGET integrated database retrieval system