KEGG   Ignicoccus hospitalis: Igni_1259Help
Entry
Igni_1259         CDS       T00587                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_1259
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_1259
   00020 Citrate cycle (TCA cycle)
    Igni_1259
   00620 Pyruvate metabolism
    Igni_1259
   00640 Propanoate metabolism
    Igni_1259
   00650 Butanoate metabolism
    Igni_1259
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igni_1259
   00680 Methane metabolism
    Igni_1259
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igni_1259
Enzymes [BR:iho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igni_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1121742..1122710
Genome map
AA seq 322 aa AA seqDB search
MALKEVGPMQEIRNHMQIPRDEYIAGGHSACQGCGHFVIIRHLLKAAGPNTIVVNPTGCV
EVVTTVFPYSSWKVPWIHVAFENGGAVASGVEAAVKVLQRKGVLPKDEQINVVVFAGDGG
TVDIGFQSLSGMLERGHKVVYVLLDNEAYMNTGIQRSGSTPFGAWTTTTPVGKRWKGEWR
VRKDMIQIAVAHHIPYAATINPAYPVDMYNKMVKALKAEGPAFLHAYSPCPTGWRFDPAK
TIEVARLAVLTGYWVLYEYDHGQYKVNVPVLKRKPIREFIKIQGRFRHMTEEQIKKLQEI
VDEYVETINKLVGKTVIGPVAE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcccttaaggaagtaggccccatgcaagaaattaggaaccacatgcaaattccgagg
gacgaatacatagctggcggccactccgcttgccaaggctgtggccacttcgtgattata
aggcacttgctaaaggcagctggtcccaacaccatagtagttaacccgacgggctgcgtg
gaagtagttactactgtgttcccctacagctcttggaaggtgccgtggatccacgtagcc
ttcgagaacgggggagcggtggcctcgggagtagaggccgccgtgaaggtgcttcagagg
aagggcgtcctccccaaggacgagcaaatcaacgtagtggtcttcgcgggcgacgggggt
actgttgacataggcttccagtcgctctccggcatgttggagaggggccacaaagtagta
tacgtcctcttggacaacgaagcttacatgaacaccggcattcagaggtccggctctacg
cccttcggcgcttggactaccacgacgcccgtggggaagaggtggaagggcgagtggagg
gttaggaaggacatgatccagatagcagtggcccaccacataccgtacgctgccacgata
aaccccgcttacccggtggacatgtataacaagatggtaaaggcccttaaggcggaaggg
ccggcgttcctacacgcctacagcccgtgccccaccgggtggaggttcgacccggccaag
accatagaggtggccaggctggcggtgctcacaggctactgggtgctgtacgagtacgac
cacggccagtacaaagtaaacgtcccggtgttgaagaggaagccgatcagagagttcata
aagatccaagggagatttaggcacatgactgaggaacaaataaagaagctgcaagagatt
gtagacgagtacgtggagaccataaacaagttggtgggtaagaccgtaatagggcccgtg
gcggagtga

DBGET integrated database retrieval system