KEGG   Ignicoccus hospitalis: Igni_1329Help
Entry
Igni_1329         CDS       T00587                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
iho  Ignicoccus hospitalis
Pathway
iho00400  Phenylalanine, tyrosine and tryptophan biosynthesis
iho01100  Metabolic pathways
iho01110  Biosynthesis of secondary metabolites
iho01130  Biosynthesis of antibiotics
iho01230  Biosynthesis of amino acids
Module
iho_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igni_1329
Enzymes [BR:iho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Igni_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABU82505
JGI: Igni1329
UniProt: A8AC53
Position
1182111..1182875
Genome map
AA seq 254 aa AA seqDB search
MLEKIIDITVKRVEEERKRLALPKRFKPVRDFRGSLERGAFAVIAEFKPSSPSGVKARWG
LLEYLERVKAADALSVLTEPRFFKGSYYNLARAATLTDKPILFKDFVVDPFQIEAAYAFG
ADAVLLMIDVLGEDDLKYMALKAKSLGLQTLVEVSKPEDASVSEEAWVDVLGVNSRDFKT
LKTDIKRIFKATRYIAERAFPLAESGVKGSRDAYELALRGYRGALVGTSLMESPDPLGSL
LSIKRAGSAGLGRI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgctagagaagataattgatatcacagttaagagagtggaagaggagcgcaagcggttg
gctctgcccaagaggttcaagcccgtgagggacttccgagggagcttggagaggggcgct
tttgctgtcatagcggagttcaagccctcctcccccagcggggtcaaggcgaggtggggg
ctgttggaatatttggagagggtcaaggcggctgacgccctctcagtgctcaccgagccc
cgcttcttcaagggctcctactacaacttggcgagggccgcgacgttaacggacaagccc
atattgtttaaagacttcgtggtcgaccccttccagatcgaggccgcctacgccttcgga
gcggacgcggtgttgttgatgattgacgtcttaggagaggacgacctaaagtacatggct
ctcaaagcgaagtcgctgggcctccagacgttggtagaggtcagcaagcccgaggacgcg
agcgtttccgaagaggcgtgggttgatgtgttgggcgtgaactcgagagactttaagacg
ttaaaaaccgacataaagaggatatttaaagctacaaggtacatagcagagagggccttc
cccctagccgagtccggggttaaggggtcgagggacgcttacgagttggccctcaggggc
taccggggagcgttggtggggacgagcttgatggagagtcccgacccgctgggctccttg
ctgtctataaagagggccggcagcgcggggctgggcaggatttag

DBGET integrated database retrieval system