KEGG   Ignicoccus hospitalis: Igni_1361Help
Entry
Igni_1361         CDS       T00587                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
iho  Ignicoccus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igni_1361
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igni_1361
   00052 Galactose metabolism
    Igni_1361
   00500 Starch and sucrose metabolism
    Igni_1361
   00520 Amino sugar and nucleotide sugar metabolism
    Igni_1361
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Igni_1361
   00524 Butirosin and neomycin biosynthesis
    Igni_1361
Enzymes [BR:iho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Igni_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1216887..1217798
Genome map
AA seq 303 aa AA seqDB search
MDYLNSEAFDERPVGVADVGGTKTRVALYENDSLKELEEFPTPKEEPLWKPLWSYFKDKE
VQNIVIATMGPLKMSEGKVVSNPHSQIKDQEVGRPLMERLKIPVLVINDCVAGAYAEFKA
RNVENLVYLAFGTGVGAGAVVDGRLLLGREGNAHEVGHFVMSLGLGLRCGCGKTDHAEAV
LGGSNIVNYFKREGFEARNAAELFNLIRSNPKAFELFKRALNSFVSSVIAFYDPEVVVLG
GGVFSKNKKVFFSALEELEDYLLWEAPKVEEALYGELSPLYGAGALGVERPQWLIKKLRY
VFK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggactaccttaatagtgaggcgttcgacgaaaggccggttggcgttgcagacgtcggg
ggcaccaagaccagggtagccttgtatgaaaacgactccttaaaggagctggaggagttc
ccgacccctaaagaggagcccctctggaagcctctttggagctacttcaaggataaagaa
gtccaaaatatcgtgatagctaccatgggacccctaaagatgagcgagggaaaggtggtc
tctaatccccattctcaaattaaagatcaagaggtcgggaggcccttaatggaacgcttg
aagattccggtcttggtgatcaacgactgcgtcgcgggggcttacgcggagttcaaggcg
aggaacgtggagaacttagtctacttagcctttggcaccggagtgggggccggcgccgtc
gtagacgggaggctcttactagggagggagggcaacgcccacgaggtcgggcacttcgtc
atgtccttaggcctcgggttgaggtgtgggtgcggtaagacggaccacgccgaggcggtg
ttgggcggaagtaacatagtaaactatttcaagagggaaggcttcgaggcccggaacgcg
gccgagctgttcaaccttatcagatctaacccaaaggccttcgaacttttcaagagggct
ttgaactcgttcgtcagctcggtgatagctttctacgatccggaggtagtggtcctagga
gggggcgtgttttcaaagaataagaaggttttcttctctgcgctggaggaactggaggac
tacttgttgtgggaagccccgaaagtcgaagaagccctctacggcgagctgagccccctc
tacggggcgggagctttaggagtagagaggccccagtggttaataaagaagttgaggtat
gtgttcaagtag

DBGET integrated database retrieval system