KEGG   Ignicoccus hospitalis: Igni_1371Help
Entry
Igni_1371         CDS       T00587                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
iho  Ignicoccus hospitalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:iho00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1227119..1227964
Genome map
AA seq 281 aa AA seqDB search
MAQPPLVFGGRLEEGSPYAVLGVPLEHGPTFREGTRWAPLEVRKASNYIEFRCELSGSDA
DLLGFYDLGDVPVVNDVKESLKLVEAEVSSTKKVPLIIGGEHTLTYAALKALRPDCLVVF
DAHLDARDEYAGDPWSHASWLRRALEELELSRVAVAGARAYVEEEARFLGKRGVLFGKDL
RGFLKRYLRGCKSIYVSLDMDYFDPSVVPGVSNPEPGGATFSDFLEHVKELQHLPLAGAD
VVELSPPYDPSGVSAVYAARALIELATSLRPLSRSPLSPSR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaccccccttggtcttcggcgggcggctagaggagggctcgccctacgcggtg
ttaggggtacctctggagcacgggcccacgtttagggaaggcacccggtgggccccgtta
gaagttcgcaaggcctccaactacatcgagtttaggtgtgagctcagcggctcggacgcg
gacctcctcgggttttacgacttgggcgacgtccccgtggtcaacgacgtgaaggagtcc
ttaaagctcgtcgaggctgaagtaagctcgactaagaaagttcctttgataatagggggc
gaacataccctcacttacgccgcgctaaaggccttgaggcccgactgcctagtggtcttc
gacgcccacttggacgcgagggacgagtacgcgggagacccttggagccacgcgagctgg
ctcaggagggcgctggaggagctcgagctctcgagggtggcggtagccggggccagggcg
tacgtcgaggaggaggcccggttcctagggaagagaggagtgttgttcgggaaagacttg
agaggatttttaaaaaggtacttgagggggtgcaagtcgatatacgtaagcttggacatg
gactacttcgacccctcggtggtccccggagtctccaacccggagccggggggagcgacg
ttctcggacttcttagagcacgtaaaagagttgcaacacttgcccttagccggcgcggac
gtggtggagctctccccgccctacgacccctccggggtcagcgcggtctacgccgcgagg
gccctcatagagttagctacttctttgagacctctttctcgatctcctctaagtccatct
cgttga

DBGET integrated database retrieval system