KEGG   Idiomarina loihiensis GSL 199: K734_01225Help
Entry
K734_01225        CDS       T02681                                 

Definition
formamidopyrimidine DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ili00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    K734_01225
Enzymes [BR:ili01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     K734_01225
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     K734_01225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259787..260599
Genome map
AA seq 270 aa AA seqDB search
MPELPEVEVSRLGISPHIEGRTIKSVKVHDKRLRWPVPETVHKVEGHVLRSVSRRSKYLL
LQTDNGCLILHLGMSGKLRVVPAETTHYKHDHIDIEFDNGQTLRLNDPRRFGALLYSESD
VSGHELLSQLGPEPLTDAFNIDYLFERSRGRSQSVKTFLMDNKVVVGVGNIYANEALFKA
GINPKRAAGKISKVRYQKLVPIIKETLASAIELGGTTLKDFTQVDGNPGYFAQKLQVYGR
GGKLCMVCSNRLKEVRLGQRSTVYCTQCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttacccgaagttgaagtcagccgtttaggcatttctccacacattgaaggc
cgcacaattaagtcggttaaggttcacgataagcgcctgcgctggccagtccctgaaact
gtgcacaaggttgaagggcatgttttgcgttcggttagccgccgttcaaaatatttgttg
ttgcagacagataatggctgtctgatattgcatttgggtatgtcgggtaagctgcgtgtg
gttccagccgaaacgactcactacaaacatgaccatattgatattgagttcgataacggg
caaaccctgcgtttaaatgatccgcggcgttttggtgctttgctatatagtgagagtgat
gtaagcgggcatgaactgctaagccagcttggcccggaaccgttaaccgacgcgtttaat
atcgactatttatttgagcgctcacgcgggcgttcgcagtcggtgaaaacctttcttatg
gataataaagtggtcgtgggtgttggcaatatttacgcgaacgaagccttgtttaaggcg
ggtatcaacccgaaacgggcggccgggaaaatcagtaaagtgcgctaccagaaactggtg
ccgataataaaagaaactctggcaagtgctattgaactgggtggtactaccttaaaagat
tttactcaggtggacggtaacccgggctatttcgctcagaaacttcaggtttacgggcgt
ggcggtaagctttgcatggtgtgcagtaaccggttgaaagaagttcgtctgggtcagcgc
agcaccgtgtactgcacccagtgccagcgctag

DBGET integrated database retrieval system