KEGG   Idiomarina loihiensis GSL 199: K734_01810Help
Entry
K734_01810        CDS       T02681                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ili00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    K734_01810
Enzymes [BR:ili01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     K734_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378056..378637
Genome map
AA seq 193 aa AA seqDB search
MASLYFTYSAMNAGKSTSLLQVAHNYEERQQHVLLMTPALDDRAGKGRIASRLGIGRDAV
SFTHRTDLAAVVRARYMQQAIDCVLIDEAQFLSEEQVWQLSSLADTDNIPVMCYGIRTDA
FGNAFPGSAVLLAIADKLVEMKTICHCGRKATMSLRVDEQGNAIRMGQQIAIGGNDRYVS
CCRKHWKEAMGLR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttatatttcacttactcggcaatgaatgcaggcaaaagtacgtcgttattg
caagtggcgcacaattacgaagagcgccaacaacatgtcctgctaatgacgccggcttta
gatgatcgggcaggtaaaggacgtattgcttcccgattaggaattggtcgcgatgcggtg
tctttcacacaccggacagatttagctgccgtagtccgggctcgctacatgcaacaggca
attgactgtgtgttaattgatgaggcgcagtttttaagtgaagagcaggtgtggcaactg
tccagtctggctgacaccgacaatattccggtaatgtgttacggcatccgcaccgacgct
tttggcaacgcctttccgggtagtgcggtgttgttggctatagccgacaaactggtggaa
atgaaaaccatctgccactgcggtcgcaaagcgaccatgtcattgcgggttgacgagcag
ggaaatgcaatacgtatgggacagcaaatagctattggtggcaatgatcgttacgtttcc
tgttgtcgtaaacactggaaagaagccatggggctgcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system