KEGG   Idiomarina loihiensis GSL 199: K734_04145Help
Entry
K734_04145        CDS       T02681                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ili  Idiomarina loihiensis GSL 199
Brite
Enzymes [BR:ili01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     K734_04145
Secretion system [BR:ili02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   K734_04145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(881657..882388)
Genome map
AA seq 243 aa AA seqDB search
MRNLMSVVGLVGLVGASFSAPAISAEQSEVDTRHLNKIGIEVLSTEPGEIDGYVRAVTNQ
GMFYVSDDGERLISGNVFDITGSEPENLSEAGMAKVRLKMLKGFADDMIVYPAEDEKYQV
TVFTDTTCGYCQRLHENMDSYHAQGITIKYLAFPRGGMSSKGGKQLQTVWCADDKKGAIT
AFKEDENYSGDSSCSNPVAEHYQLGKSFGVSGTPAIVLPDGRLVPGALPASRLIAEIKKG
ESQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatttaatgtctgtagttggattagtagggctggtcggcgcaagtttcagtgcg
ccggctattagtgcggaacaaagtgaagtcgacacccggcacctgaataaaattggtatt
gaagtgttgtccacagagcccggtgaaattgacggctatgtccgtgcggtgactaatcag
ggcatgttttatgtgtcagatgacggtgaacggcttattagcggcaatgtgtttgatata
accgggagtgaaccggaaaatttaagtgaagccggcatggctaaagttcgcctgaaaatg
ctaaaaggctttgctgacgatatgatcgtgtacccggctgaggacgagaaatatcaggta
acggtttttactgacactacctgcggttattgtcagcgcctgcacgaaaacatggacagc
tatcacgcacaaggcattaccataaaatacctggcctttccccgtggtggtatgagtagc
aaaggcgggaagcagttacaaaccgtttggtgtgcggatgacaaaaaaggggccattacc
gcctttaaagaagacgaaaattacagtggcgactcaagctgttccaatccggttgctgag
cactaccaactgggcaaatcttttggggtaagcggtacgcccgctatcgttctgcccgac
ggtcgcttagtaccgggggcgttacctgcatcacgcttaattgctgaaattaaaaaaggt
gagtcacagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system