KEGG   Idiomarina loihiensis GSL 199: K734_09475Help
Entry
K734_09475        CDS       T02681                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ili00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    K734_09475
Enzymes [BR:ili01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     K734_09475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2014359..2015699)
Genome map
AA seq 446 aa AA seqDB search
MFLAQEVIRKKRDAVSLSDTDIQQFVNGICDDSVSEGQIAALAMAIYFRGMSAQEKTALT
VAMRDSGDVLDWRQDNLNGPVLDKHSTGGVGDVVSLMLGPIVAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTAPDNRRFRDTVKQAGVAIIGQTGRLAPADSRFYATRDVTATVESI
PLITASILAKKLAEGLDGLVMDVKAGNGAFMPGYDESRELAQSLVSVGRKLGVETTALIT
DMNQALGSAAGNAVEVQLAVDYLTGKRRDKRLHQVTKALSAELLVSGNLAKSTDQAEVMV
ENVLGSGLAAERFAKMVGSLGGPHDFLEKSDQYLPQANLRKPLKLPAEYHGLYLSEVNTR
ELGMAVVCLGGGRRKADDKLDLSVGMTDILTVGSKVDSESVIATVHASNESDWQEAADSI
LKALSFSSTPPEPDSVIYERIAGETE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggcgcaagaagttattcgcaaaaagcgtgacgctgtaagtttatccgacacc
gatattcagcagttcgttaacggaatttgcgatgatagcgtcagtgaggggcaaatagct
gcgttggctatggctatttattttcgcggtatgtcggcgcaggaaaaaacagctttaacc
gttgctatgagagattccggcgatgttcttgactggcgacaggacaatttaaatggtccg
gtattggataagcactcaaccggcggtgtcggtgacgtcgttagtttaatgctgggtcct
attgtcgcagcctgtggtggctatgttccgatgatttcggggcgtggtctgggacatact
ggcggtacgctggataaatttgacgccatccccggctatcagaccgcgccggataatcgg
cgctttcgcgacacggttaagcaggctggtgttgccattattgggcaaacagggcgtctg
gcaccagctgatagccgcttttacgcaacgcgcgatgtgaccgcgacagtggagtcgatt
ccgttaattacagcttctattctggcaaaaaagctggctgaaggccttgatggtttggtt
atggatgttaaagccggtaacggtgcattcatgccaggatacgatgagtcgagagagtta
gcgcagagtctggttagtgttggccggaaactgggagtagaaaccacggcgcttattact
gacatgaatcaggcattaggttcagctgccggtaatgcggttgaggttcagttagccgtc
gattatttaacgggaaagcgcagagataaacgcctgcatcaggtaacaaaagccttatct
gctgagttgctggtgtcgggaaacttggctaaaagtactgaccaagctgaggttatggtt
gaaaacgtactgggaagcggtttggcggcggaacgtttcgccaaaatggtcggttctttg
ggtggacctcacgactttctggaaaaaagcgaccagtacctgccccaggcaaacctgaga
aaaccgttaaagcttcccgccgagtatcatgggctatatttatcggaagtgaatacaaga
gaattgggaatggcggttgtctgtttaggtggaggccggcgcaaagctgatgataaattg
gatttaagcgttggtatgaccgatatcctgacagttggatcgaaagtggactcagagagt
gtcattgcaacagtgcatgccagtaacgagtcggactggcaagaggctgctgacagcata
ctgaaagctttgagtttttcctctaccccgccggagcccgactctgttatctatgagcgc
atagccggagagactgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system