KEGG   Idiomarina loihiensis L2TR: IL0104Help
Entry
IL0104            CDS       T00218                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    IL0104
Enzymes [BR:ilo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     IL0104
    3.5.1.-  
     IL0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109745..110302
Genome map
AA seq 185 aa AA seqDB search
MKATFEQNDALIIVDVQNDFCPGGKLALDEGDEVVPVINALSAQAQEAGIPVFVSRDWHP
RHHVSFDERGGPWPEHCVQDTKGAEFHPDLILPENARLVSKGARFDIDQYSAFDKTGLVS
ELVHLNIKRVWVVGLALEVCVKATALDATKNDYETFLVEEGTRFIDRADAEKAREELREA
GVIFK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgacttttgaacaaaacgatgcacttatcattgtggatgtacaaaacgatttt
tgtccgggcggcaagctggcgctggatgaaggtgacgaggttgtgcccgttattaatgca
ctgagcgcacaggctcaggaggctggcattccggtctttgtttcaagagactggcatccg
cgacatcatgtgagttttgacgagcgcggcgggccatggcccgagcattgtgtacaggat
accaagggcgctgagtttcatcctgatcttattttgcccgagaacgcccgtttagtctct
aaaggggctcgtttcgatattgatcaatattctgcgttcgataaaacggggttggtttcg
gaacttgtgcaccttaatatcaaacgcgtatgggttgtcggcctggcgctggaagtgtgt
gtaaaagccacggcactagacgccacaaaaaatgactatgaaacttttttagtggaagag
ggcacccgctttatcgatagagctgacgctgagaaagccagagaagagctcagagaggca
ggtgttatctttaaataa

DBGET integrated database retrieval system