KEGG   Idiomarina loihiensis L2TR: IL0278Help
Entry
IL0278            CDS       T00218                                 

Definition
Fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ilo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ilo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
293049..294188
Genome map
AA seq 379 aa AA seqDB search
MQKISEKPPIIWLNTLVFSITFIVAIVGVPLYAYSVGIGAAFWWVMLGTACFAGLSITAG
YHRLWAHRTYDANPVIRFIFAIGGAVALQNSALHWSSDHREHHKHVDDNDKDPYSAKRGF
WYSHIGWMIREYQASRYTDYDNVKDLQKDPIVMWQHKYYLPLTLFVNFGWPIAAGFMLGD
VWAGLLVIGVLRLVLNHHTTFFINSLAHIWGKQPYTDKNTARDNGVLAFLTFGEGYHNYH
HIFAADYRNGIRWWQFDPTKWLIVASKWLGLAKNLKRSSPYQVERAKLQMQLKRAQLKAQ
AAPESLFERAQEHYDQMGQQLKAYYQARKKLLDTKAKALKEHVHHDIDALKRQVDEMKAS
LEMQKRSWKALLNQIQQHA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatttctgaaaagccccccattatctggttaaacaccctggtgttctctatt
acctttattgtcgccattgttggtgtacctttatacgcatacagcgttggcattggtgcc
gcgttttggtgggttatgttgggcacggcgtgtttcgccggcttatctattactgcgggc
tatcatcgcctgtgggcgcatcgtacatacgatgcaaacccggtaattcgttttattttt
gccattggcggtgcggttgcgctgcagaacagtgcgcttcactggtcttctgaccaccgt
gagcaccacaagcacgttgatgacaacgacaaagacccgtattcagctaagcgaggcttc
tggtactcgcatattggctggatgatccgtgaatatcaggcgagccgttatactgactac
gataacgttaaagacctgcagaaagacccaattgttatgtggcagcacaagtattacttg
ccgctaactctgtttgtgaactttggctggccaattgccgccggtttcatgctgggcgac
gtgtgggcaggattgttggttattggcgtgttgcgcctggtgctaaaccaccacaccact
ttctttattaactcgctggcgcatatttggggtaaacagccttataccgacaaaaacact
gcgcgcgacaatggcgtgctggcgtttctgacgtttggcgagggttaccataattaccac
cacatttttgccgcggattatcgtaacggtattcgctggtggcagttcgacccaactaaa
tggctgatcgtagccagtaaatggctgggtctggcgaaaaacttaaagcgcagctcgccg
tatcaggtcgagcgggcgaaactgcaaatgcagttaaaacgagctcagctgaaagctcag
gcagcgccggaatctttgtttgaaagggctcaggaacattatgaccagatgggccagcag
ttgaaggcatattatcaggctcgtaaaaagcttctggatactaaagctaaagccttgaaa
gaacatgtgcatcacgatattgatgcgttgaagcgtcaggttgatgaaatgaaggcttcg
ctggaaatgcaaaaacgctcctggaaagcgctattaaatcaaattcagcagcacgcgtaa

DBGET integrated database retrieval system