KEGG   Idiomarina loihiensis L2TR: IL0324Help
Entry
IL0324            CDS       T00218                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ilo00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333509..334333
Genome map
AA seq 274 aa AA seqDB search
MAETMLEKLKEIAFEAGGVILSMYERRDYKTAEKKDDSPVTTADLVASELIEDRLKQSFP
DIPVISEESEHQDYNERRQWRAYFIIDPIDGTQEFISRSGDFAVNIAYVENNEPVIGVIF
WPVGETLYYARKGAGAFKQKENEKQSISVRKFSDPQADPIIIAISRQQAREPVFNRLQTK
RDIQPLPTGSCSLKACFIAEGKADCFLRLGPTGEWDTAASQVIVGEAGGRIVNENFEPIT
YNRTVSLLNPNFLVLGDQNVPWEEVFIARQARFR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaacaatgctggagaaactgaaggaaatagcattcgaagcaggtggcgttatt
ctgtcaatgtacgagcggcgtgactataaaacggccgagaaaaaagacgattctccagtg
actaccgcagatcttgttgccagcgaactaatagaagatcgactcaagcagtcattccct
gatattccggttatttctgaagaaagcgagcatcaggactataatgagcgccgtcagtgg
agagcctattttattatcgacccgatagatggtactcaggagtttatttcccgctccgga
gactttgctgtcaacattgcttacgtagaaaacaacgagcctgtcattggcgttattttc
tggccggtcggggaaacgctttactatgctcgcaaaggtgctggcgcctttaaacaaaaa
gagaacgaaaagcagtccataagcgtgcgcaagtttagtgaccctcaggctgaccctatt
attattgcaataagtcggcaacaggcacgagagcctgtgtttaatcgtttgcagacaaaa
cgtgatattcagcctttaccaacgggtagctgttcactaaaagcctgttttattgccgag
ggcaaagccgattgttttttacgtctgggacctaccggagaatgggataccgctgcatcg
caagttattgtaggagaagctggcggtcgcatagtgaatgagaactttgagcccattacc
tacaaccgcacggttagcctgctgaacccgaacttcttagttctgggtgaccaaaatgtt
ccctgggaagaagtctttattgcccgtcaggctcgtttccggtaa

DBGET integrated database retrieval system