KEGG   Idiomarina loihiensis L2TR: IL0431Help
Entry
IL0431            CDS       T00218                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    IL0431 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IL0431 (murE)
Enzymes [BR:ilo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     IL0431 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444835..446298
Genome map
AA seq 487 aa AA seqDB search
MKLAELLTMLPTSFSVPDVTVSGIKLDSRQVANGDVFVAIPGYETDGRAYIDAAIDAGAA
AIIAEAPGMAVEQRRGVVVIGFSGVREHLSRIAGNFFGHPSEKMNLVGVTGTNGKTSVTH
IMAQLAKALGMEAAVIGTTGSGLIGRLLPERHTTPDAVTVQQRLATLLAEGAELVAMEVS
SHALIQRRVEALHFAAAAITNISRDHLDYHGTMENYVAAKQRLFADFGVQNRVVNADDDT
LSHWQQDDLADLWVSLNASPNEPCLQATGVQFHEQGSVFSLNWQGESCVVETPLLGRFNV
YNLLCAVAVLLKLNKPLADIGKACGRLQPVPGRMEAFHNNQSPLVVVDYAHTPDALHQVL
SALRLHCKGRLWCVFGCGGDRDRGKRPQMGKVAADYADVVVVTDDNPRTEPAEQIIEDIL
TGIADKTQVKVWPGRREAVIRAMQEAGKDDVVLLAGKGHEDYQVIGTQRIDYNERAVVSE
WLQGDCA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgcagagttgttaactatgctgccgacgtcgttttccgttccggatgttacc
gttagtggtataaaactcgatagtcggcaagtagccaatggcgatgtttttgtcgctatt
ccgggctatgaaaccgatggccgcgcttatattgatgcagctattgatgctggtgcagca
gcaattattgctgaagctccgggaatggctgttgaacagcgccggggcgtggtcgttatc
ggttttagtggcgttcgtgagcatctctcccgcatcgccggtaattttttcggccatcca
tcagagaaaatgaacctggttggtgtgaccggaaccaatggtaaaacgtcggttactcac
attatggcccagttggcaaaagccctgggtatggaagcggctgttattggtacaaccgga
agtggacttattggtcgcttattacctgagcgtcataccacaccagatgccgttaccgtc
caacaacgtctggctacgctattagctgaaggcgcagaactggttgctatggaggtgtct
tcacacgcactgatacagcgccgtgtcgaggctttacactttgcggcggccgccataacc
aatattagtcgggatcatctcgactatcacggcaccatggaaaattacgtggccgcaaaa
caacgtttatttgctgactttggcgtgcaaaaccgagtggttaacgccgacgacgacacg
ttaagccattggcagcaggatgatttagccgatttgtgggtaagtcttaatgccagcccc
aacgaaccatgcctgcaggcgactggtgttcagttccatgagcagggctcggtgttcagt
ttaaattggcagggtgaatcctgcgtcgttgaaactccattgttgggccgtttcaacgtt
tataacttactctgcgcggttgccgtactgctgaaactgaataagccacttgcggatatc
ggcaaagcctgtggcaggttgcagcccgttcccgggcggatggaagccttccataataat
cagtcgccgctggtggtggttgactacgcgcatacaccggacgctctgcatcaggtattg
agtgcgctgcgcctgcattgcaagggccgtttgtggtgtgtgtttggctgcggcggtgac
cgtgaccgtggcaagcgtccgcaaatgggtaaagtcgcggcagattacgctgatgttgtt
gtggttaccgatgacaacccgcggacagaacccgcggaacaaattattgaagatattttg
accggcattgcggataaaactcaggttaaggtttggccgggtcgccgcgaggcggtgata
cgtgcaatgcaggaagccggaaaagatgacgttgtattactcgccggtaaaggacacgaa
gactatcaggttattggtactcaacgcattgactataacgaacgagcggtagtcagtgaa
tggctgcaaggagactgcgcatga

DBGET integrated database retrieval system