KEGG   Idiomarina loihiensis L2TR: IL0608Help
Entry
IL0608            CDS       T00218                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ilo01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ilo00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(658845..660182)
Genome map
AA seq 445 aa AA seqDB search
MTTQNLSFAQQVKELQKQWDTDPRWKGVERPYSAEDVVRLRGSVQPEYTYARNGADKLWQ
LIHGKAQEKFGKDYVNALGALTGGQAVQQVKAGLQAIYLSGWQVAADNNSACSMYPDQSL
YPVDSVPTVVERINNSFARADQIQWSKGVTPEDDNYVDYFAPIVADAEAGFGGVLNAYEL
MKRMIQSGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLSAARLAADVAGTPTLIVA
RTDANAADLLTSDFDPNDKPFITGERTAEGFYRVKPGIEQAISRGLAYAPFADLIWCETA
KPDLDEARQFAEAVHAKYPGKLLAYNCSPSFNWKRNLDDDTIAKFQRELAAMGYKFQFIT
LAGVHNMWYHMFELAHDYARNDMSAYVKLQQQEFEAADKGYTFVAHQQEVGTGYFDELTN
VIQGGLSSVTALKGSTEEDQFKTSA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccagaatctttcattcgcacaacaggttaaagaattgcaaaagcaatgggac
accgacccacgctggaaaggtgttgagcgcccctacagtgccgaagacgttgtgcgcctg
cgtggtagcgtgcagccagaatacacctacgcccgcaacggtgccgataagctatggcag
ctgattcacggcaaagcacaggaaaagtttggcaaagactatgtcaacgcattgggtgct
ttaaccggcggtcaggcggttcagcaagttaaagcgggtctgcaggccatttacctttcc
ggctggcaggtggcggccgataacaactcggcctgcagcatgtacccggatcagtcgtta
tatccggtcgactcagtacctacggttgtcgagcgcattaacaactcattcgcccgtgct
gatcagatacagtggtcaaaaggcgttacgccggaagacgacaattacgtagactacttc
gcacctattgttgccgacgcggaagccggttttggtggcgttctcaatgcctacgagctg
atgaagcgcatgatccagtccggtgctgccggagtgcattttgaggatcaactggcttca
gtgaaaaaatgcggacacatgggcggtaaagtactggtacccacacaagaagcggtgcag
aaactttcagccgcacgtttagctgccgatgttgccggtacaccgacactgattgtcgcc
cgtactgacgctaacgccgccgatctactaacttctgactttgacccgaacgacaagccg
ttcattactggtgaacgcactgccgaaggtttctatcgcgtgaagccgggcattgaacaa
gccatttcacgcggcttagcatatgctccgtttgcggatcttatctggtgtgaaaccgcc
aaaccagacttagacgaagcgcgtcagtttgctgaagccgttcatgccaaataccccggc
aaactgctggcctataactgttcaccgtcgtttaactggaaacgcaacctggacgacgac
accattgctaagttccagcgcgagcttgccgcaatgggctacaaattccagtttattacc
ttggccggtgtgcacaacatgtggtaccacatgtttgaactggcacatgactatgcccgc
aacgacatgtcagcctacgttaaacttcagcaacaagagtttgaagcggcagacaaagga
tacacctttgtcgcgcaccagcaggaagtcggcacaggctacttcgacgagctgaccaac
gtcattcagggcgggctatcctcagtcactgcactgaaaggctcgaccgaggaagaccag
tttaaaacctccgcgtaa

DBGET integrated database retrieval system