KEGG   Idiomarina loihiensis L2TR: IL0609Help
Entry
IL0609            CDS       T00218                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IL0609 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IL0609 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    IL0609 (aceB)
Enzymes [BR:ilo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     IL0609 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(660213..661796)
Genome map
AA seq 527 aa AA seqDB search
MNNLFNFSQPLDDDAKALFNDENQSFLAELVDTFQPRLESLLKKRQQRQAQFDQGQLPDF
DSATQNIREGNWRIAELPADLKKRRLEITGPVDRKMVINALNANVDCYMADFEDSQSPTW
EGMVNGQINLRDANIGGMTYTDPDSGKHYEVGPDPALLIARVRGLHLPEKHVQRNGQAIP
GALMDFALYFLLNYQQRLQQGSGVYYYLPKLEHSDEAKWWADVFHFTEKKFSLKTSTIRA
TILIETLPAVFQMHEILHAMKDHIAALNCGRWDYIFSYIKTLKEHPERVLPDRQVVSMDK
PFLNAYSRLLVKTCHQRGALAMGGMAAFIPSKDPAKNEKILAKVHADKTMERDNGHDGTW
IAHPGLADTVRAIFVDGIEGDNQLHVLRENDTSIDQTLLLQPCEGERTEAGMRTNIRVSL
QYISSWLNGKGCVPIYGLMEDAATAEISRTSIWQWIRHGKTLSDNTPVTKELFRQYLQEE
AEVVKNEVGKQRWNDEPFEQALKLLEEITTADELVDFLTLPGYQQLK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatctatttaacttcagtcaaccccttgatgacgatgcaaaagcgctgttcaac
gacgagaatcagtcttttctcgctgagttagtcgatacctttcaaccacggttagagtcg
ctgttaaagaagcgtcagcaacgtcaggctcaatttgaccagggtcagttacctgatttt
gactctgcaactcaaaacatccgtgaaggaaactggcgcattgccgaactgccagcagat
ttgaaaaaacgccgcttagaaattaccggaccggtggatcgcaaaatggtcatcaacgct
ctgaatgccaatgtcgattgttacatggccgactttgaggattcacaatctcctacctgg
gagggcatggttaacggtcaaattaacctgcgtgacgccaacattggcggcatgacctat
accgacccagacagtggcaagcactacgaagttggccctgatcctgcactcctaattgca
cgagttcgcggcctgcacttaccggaaaagcacgtgcagcgtaatggccaagctattccc
ggcgcgctaatggactttgctttgtactttttactgaattaccagcagcgactacaacaa
ggttcaggtgtgtattactacctgcccaagctggagcacagcgacgaagccaaatggtgg
gccgatgtttttcactttaccgagaaaaaattcagcttaaaaaccagcaccattcgcgcc
accatactcatagaaaccctgccggcagtgtttcagatgcatgaaatactacacgccatg
aaagaccacattgctgcacttaactgcggccgctgggattacattttcagttacataaaa
accctgaaagaacatcctgaacgggttctgcccgaccgtcaggtggttagtatggacaag
ccctttcttaacgcctattcgcgcttgttagtgaaaacctgtcaccagcgcggggcttta
gctatgggcggcatggcagcctttattcccagcaaagatccagccaagaatgagaagatc
ctcgctaaagttcacgccgacaaaaccatggagcgcgacaatggccacgacggcacctgg
attgcccacccgggcttagctgacaccgtacgcgcaatttttgtcgacggtattgaaggc
gacaaccagcttcacgtactgcgtgaaaacgacacctcgattgatcagaccttactgctg
caaccctgtgagggcgagcgtactgaagccggtatgcgcaccaacattcgggtatcgctg
caatacatttcctcttggctgaacggcaaaggctgcgtgcctatctacggcttgatggaa
gacgccgccaccgctgaaatttcacgtacctcaatctggcagtggatccgccacggcaaa
accctgtccgacaacaccccggtcaccaaagagctgttccggcagtatctgcaggaagaa
gctgaggtagtgaaaaacgaagtgggtaaacaacgctggaacgacgaaccttttgaacag
gcattaaagcttttagaagaaattaccacagccgacgagctggtcgactttctgaccctg
cccggctaccaacaactcaagtaa

DBGET integrated database retrieval system