KEGG   Idiomarina loihiensis L2TR: IL0748Help
Entry
IL0748            CDS       T00218                                 

Gene name
pcm
Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ilo  Idiomarina loihiensis L2TR
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(808325..808966)
Genome map
AA seq 213 aa AA seqDB search
MISNGQSRVKRLIQQLEALGITNKEVLRVISETPRHLFMPESLAHKAYENTALPIGNGQT
ISQPLMVATMTQLLMQHHCKNVLEIGTGSGYQTAVLAQLVDKVFSVERIATLQYQAKRRM
RQLDLHNVAMRHGDGWKGWRSKGPFDGIIVTAAASDIPQDLVDQLADGGVMIIPVGEQHQ
SQSLVVMRRFGDSLEQQRIGDVRFVPLVKGDVV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattagtaatgggcagtcgcgggttaagcgactgattcaacaattagaggctctcggt
attaccaacaaagaggttttacgggtgatatctgaaaccccaagacatctgtttatgccc
gagtcgttagctcacaaagcctatgaaaatacggcgctgcccattggtaatgggcagaca
atttcgcagccattaatggtggcaacaatgacgcagttattaatgcagcatcattgtaaa
aatgtgctggagataggcaccggctcaggctatcagacggcggttctggctcagttggtt
gataaagtctttagtgttgagcgcattgctacgttgcagtatcaggccaagcgccgcatg
cgtcagctggatttacataatgttgctatgcgtcatggtgatggctggaagggctggcgc
agcaaaggtccgttcgacggcattattgttaccgccgcggccagcgacatacctcaggat
ttagtcgatcagcttgccgacggcggcgtgatgattattccggtcggcgagcagcaccaa
tcgcagagccttgtcgttatgcgtcgctttggtgattcgctggagcaacagcgtattggt
gatgtgcgtttcgtgcctttagttaagggagatgtcgtttga

DBGET integrated database retrieval system