KEGG   Idiomarina loihiensis L2TR: IL0825Help
Entry
IL0825            CDS       T00218                                 

Gene name
dsbC
Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ilo  Idiomarina loihiensis L2TR
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(881542..882273)
Genome map
AA seq 243 aa AA seqDB search
MRNLMSVVGLVGLVGASFSAPAISAEQSEVDTRHLNKIGIEVLSTEPGEIDGYVRAVTNQ
GMFYVSDDGERLISGNVFDITGSEPENLSEAGMAKVRLKMLKGFADDMIVYPAEDEKYQV
TVFTDTTCGYCQRLHENMDSYHAQGITIKYLAFPRGGMSSKGGKQLQTVWCADDKKGAIT
AFKEDENYSGDSSCSNPVAEHYQLGKSFGVSGTPAIVLPDGRLVPGALPASRLIAEIKKG
ESQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatttaatgtctgtagttggattagtagggctggtcggcgcaagtttcagtgcg
ccggctattagtgcggaacaaagtgaagtcgacacccggcacctgaataaaattggtatt
gaagtgttgtccacagagcccggtgaaattgacggctatgtccgtgcggtgactaatcag
ggcatgttttatgtgtcagatgacggtgaacggcttattagcggcaatgtgtttgatata
accgggagtgaaccggaaaatttaagtgaagccggcatggctaaagttcgcctgaaaatg
ctaaaaggctttgctgacgatatgatcgtgtacccggctgaggacgagaaatatcaggta
acggtttttactgacactacctgcggttattgtcagcgcctgcacgaaaacatggacagc
tatcacgcacaaggcattaccataaaatacctggcctttccccgtggtggtatgagtagc
aaaggcgggaagcagttacaaaccgtttggtgtgcggatgacaaaaaaggggccattacc
gcctttaaagaagacgaaaattacagtggcgactcaagctgttccaatccggttgctgag
cactaccaactgggcaaatcttttggggtaagcggtacgcccgctatcgttctgcccgac
ggtcgcttagtaccgggggcgttacctgcatcacgcttaattgctgaaattaaaaaaggt
gagtcacagtaa

DBGET integrated database retrieval system