KEGG   Idiomarina loihiensis L2TR: IL0839Help
Entry
IL0839            CDS       T00218                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00900  Terpenoid backbone biosynthesis
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IL0839
Enzymes [BR:ilo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     IL0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NmrA NAD_binding_3 Sacchrp_dh_NADP GFO_IDH_MocA DapB_N
Motif
Other DBs
NCBI-ProteinID: AAV81679
UniProt: Q5QUF4
Position
complement(896488..897681)
Genome map
AA seq 397 aa AA seqDB search
MRRITVLGATGSIGQNTLNVVSRHPDDFQVFALTAHSQISAMAELCVKHNPQYAVMGSYN
AAAELKALLGQQTSTQVMYGDQALAEVSSDAEVDVVMAAIVGAAGLSPTLAAIDAGKDVL
LANKEALVMSGQLFIDHAQRSGARIIPVDSEHNAIFQCLPQAAQQQVGTMALAEHGIQYL
LLTGSGGPFRDIPLEELPQQTPGAACNHPNWSMGRKISVDSATMLNKGLEYIEARWLFNC
SRDQLKVVIHPQSVIHSMVQYTDGSVLAQMGEPDMRTPIAHSLGYPERLESGVAGLDFTQ
IAELTFKQPEAQRYPCLQLAIEACWEGQWATTALNAANEVAVAAFLQEQVGFTDIAKVCD
SVLQSIQADEADSLETLLAIDKQARLAANKWLQEYAQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaataacagttttgggagcaaccggctctattggtcaaaacacattgaacgtt
gtctcacggcatccggatgactttcaggtttttgccttaacagcccatagccagattagt
gctatggctgagctttgtgtaaagcataatccgcaatacgcggttatgggttcatacaat
gctgctgctgagcttaaagcacttctcggtcaacagacttcaactcaggttatgtatgga
gatcaggctttagctgaggtcagttcggacgctgaggtggatgtggttatggcggctata
gtcggtgcggccggactatcaccgacactagctgcgattgacgcaggtaaagatgtactg
ttagccaataaagaagctctggttatgagcggtcagttgtttattgatcatgctcaacgt
tccggcgctagaattattccggtcgacagcgaacacaacgctatttttcagtgtttaccc
caggctgcgcagcaacaggttggtactatggcgttagcggagcatggcattcagtattta
ctgttaaccggctccggcggtccgtttcgcgatatacctcttgaggagttgccgcaacaa
acccctggtgcggcatgcaatcacccaaattggtccatgggtcggaaaatttcagtggat
tccgccaccatgctgaacaaggggctggaatacattgaagcccgctggttattcaattgt
tcgcgtgaccaactgaaagttgttattcacccgcagagcgttattcattctatggtgcaa
tacaccgacggttccgtacttgctcaaatgggtgaaccggacatgcgcacgcctatagcc
cattcgttgggttatccagagcgtttagaaagcggtgttgcgggcttagattttactcaa
atagccgaactgacctttaagcagcccgaagcacaacgttatccgtgtttacagttggcg
atagaagcatgttgggaagggcagtgggccactactgctttaaacgcggcgaacgaagtt
gccgttgctgcatttttacaagaacaggttggttttactgatattgcaaaagtttgtgat
tcggtattgcagtcaatacaagctgatgaggccgatagcttagagacgctgttagccata
gataaacaagcgcgtttagcagccaataaatggttgcaggagtacgcacagtga

DBGET integrated database retrieval system