KEGG   Idiomarina loihiensis L2TR: IL0972Help
Entry
IL0972            CDS       T00218                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IL0972 (tpiA)
   01230 Biosynthesis of amino acids
    IL0972 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IL0972 (tpiA)
   00051 Fructose and mannose metabolism
    IL0972 (tpiA)
   00562 Inositol phosphate metabolism
    IL0972 (tpiA)
Enzymes [BR:ilo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     IL0972 (tpiA)
Exosome [BR:ilo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   IL0972 (tpiA)
  Exosomal proteins of bladder cancer cells
   IL0972 (tpiA)
  Exosomal proteins of melanoma cells
   IL0972 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1026679..1027437)
Genome map
AA seq 252 aa AA seqDB search
MPNASLVIANWKMNGNRELTKTMSAALREKLNQLQQVKLVICPPFTLIGELANQCYYDDI
AIGAQNVSEHTGGAFTGEISTAQLQEFGVSYVLVGHSERRQLFAETDKMVNEKALATVNA
GMTAVICVGENKAQRDEGNTWEVVAQQAQAALADLPKEQAGKIVLAYEPVWAIGTGETAS
PEQAQDVHAKLRALLVEQFGAIGEKMPLLYGGSVKADNAAELFAQKDIDGGLIGGASLKE
SDFVAICQAAQG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatgcatcactagtgattgcaaattggaaaatgaacggaaatcgcgagctaacg
aaaacaatgtcggcggctttgcgggaaaaacttaatcagcttcagcaagttaagttagtc
atttgtcctccgttcacccttattggcgagctggctaatcaatgttattacgatgacatt
gccattggtgctcagaatgtatctgaacacactggtggtgcctttaccggcgaaatctca
accgcacagctacaagagtttggtgttagctatgtgttagtgggacattcagaacgtcgg
cagctgttcgcagaaaccgacaaaatggtgaatgagaaagccttggctacggttaatgcc
ggtatgacagcggtgatttgtgttggtgagaataaagcacaacgcgatgagggaaacacc
tgggaagttgtagcacagcaagcgcaagcggctttagctgatcttcctaaggagcaagcc
ggtaaaattgttttggcctatgagcctgtttgggcaattggtactggagaaacggcttca
ccagaacaagcacaggacgttcatgcaaaattaagagcgttactggtagagcaatttggc
gcgattggtgagaaaatgccgttattgtacggcggctcagttaaagctgacaacgctgcc
gaattatttgcgcaaaaagacattgatggcggcctgataggtggcgcaagtctgaaagaa
tcagattttgttgctatttgccaagctgctcaagggtaa

DBGET integrated database retrieval system