KEGG   Idiomarina loihiensis L2TR: IL0993Help
Entry
IL0993            CDS       T00218                                 

Definition
(GenBank) Fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00071  Fatty acid degradation
ilo00280  Valine, leucine and isoleucine degradation
ilo00281  Geraniol degradation
ilo00310  Lysine degradation
ilo00362  Benzoate degradation
ilo00380  Tryptophan metabolism
ilo00410  beta-Alanine metabolism
ilo00640  Propanoate metabolism
ilo00650  Butanoate metabolism
ilo00903  Limonene and pinene degradation
ilo00930  Caprolactam degradation
ilo01040  Biosynthesis of unsaturated fatty acids
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
ilo01212  Fatty acid metabolism
Module
ilo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    IL0993
   00650 Butanoate metabolism
    IL0993
  Lipid metabolism
   00071 Fatty acid degradation
    IL0993
   01040 Biosynthesis of unsaturated fatty acids
    IL0993
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IL0993
   00310 Lysine degradation
    IL0993
   00380 Tryptophan metabolism
    IL0993
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IL0993
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    IL0993
   00281 Geraniol degradation
    IL0993
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IL0993
   00930 Caprolactam degradation
    IL0993
Enzymes [BR:ilo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     IL0993
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     IL0993
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     IL0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Ac81
Motif
Other DBs
NCBI-ProteinID: AAV81833
UniProt: Q5QXM1
Position
complement(1055448..1057574)
Genome map
AA seq 708 aa AA seqDB search
MSQDKAFTMEVRDDGVAVITIDVPGESMNTLKDSFAEEVGSLMNRLESDDSVKGVVFISG
KPGSFIAGADINMIDGCENAVDAESLARKGQAMFDRIEQLNVPVVAAINGACLGGGLELA
MACHVRVCTDNSKTALGLPEVKLGLLPGSGGTQRLPELVGVQQGLTMILTGKELRAKQAL
KAGLVTEVVPQSILLDVAVEHALKRKPKSTKPPLKGISKVLEATKFGRDIIFKKASEQAQ
KKAQGNYPAIDKIIQTVREGVERGREAGLDKEARSFGELAMTPESYQLRQIFFATTEMKK
ETGADGVKPDSVKRVGVLGGGLMGGGIAYVTAAKAGIPARIKDIAEDGIRHALHYSYERL
DKKVKRRHMRRAELEKTMLMLSGSLDYSGFERTDVVIEAVFEDLNLKQKMVADVEEHADE
STIFATNTSSLPITQIAAKAKRPEQVIGLHYFSPVDKMPLAEIITHPGTSDKTIATTVSL
AKKQGKTPIVVKDGAGFYVNRILAPYMNEAARLLLAGEPIEHIDKTLVKFGFPVGPITLL
DEVGIDVAAKVAPVLVKELGDRFEAPEAFEKLIDDDRKGKKNQKGFYQYGKSVKGKPVDT
SVYSLLDIDPNESKSADEIIDICLLPMLNEAAYCLQEEIIRSPRDGDIGAIFGIGFPPFL
GGPFRYMDSQGLETIVNKLEKLAAERGERYTPAPLLKQMLENGWNFYQ
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggataaagcattcactatggaagttagggacgacggcgtcgctgtaattacg
attgatgtccctggtgagtcgatgaataccttaaaagactcatttgccgaagaagttggc
agtttgatgaatcgcttagaaagcgatgattcagtcaaaggtgtggtttttattagtggt
aagccaggctcctttattgccggtgctgatatcaacatgatagacggttgtgaaaatgcc
gtggacgcagaaagtctggcgcgaaaagggcaggctatgtttgatcgcatcgagcagtta
aatgtgcctgtggttgcggctattaacggagcttgcctgggtggtggactggaactggcc
atggcttgtcatgtaagagtttgtaccgacaacagcaagacagctctgggcttacctgaa
gtgaaattaggcttgttaccgggcagtggtggtacgcaacgtctgcctgaactggttggt
gttcagcaaggactgacgatgatcctgaccggtaaagaactgcgtgctaaacaggctttg
aaagcaggacttgtcaccgaggttgttccccaaagcatattgttggatgttgccgttgag
cacgcgttaaaacgtaagccaaaatcaactaagccgccacttaagggcattagtaaagtg
ctggaggcgaccaagtttggccgtgacattatctttaaaaaggccagtgagcaggcgcag
aagaaagctcagggcaattacccggcaattgataaaatcattcagacggtgcgtgaaggt
gttgaacgtggccgcgaagctggcctggataaggaagcccgtagctttggtgagttggca
atgacgccagagtcttatcagctgcgccagattttctttgccaccacagaaatgaaaaaa
gaaaccggcgccgatggcgttaaacctgattcggtcaaacgggttggcgttttaggtggt
ggattgatgggcggcggtattgcctatgttacggcggctaaagcaggtattcctgcacgt
atcaaggacatcgctgaagacggaattcgacatgcattacattacagttacgagcgtcta
gataaaaaagtgaaacgtcggcatatgcgccgggccgagcttgaaaagaccatgctaatg
ctgagcggttcgcttgattacagtggatttgagcgtaccgacgtggttattgaagcggta
tttgaagaccttaacctgaagcaaaaaatggttgctgatgtggaggagcacgcagacgag
tcgaccatttttgcaactaatacgagctcactgcctattactcaaatagcggctaaagcc
aagcgcccggaacaggttattgggctccactatttttctccggtcgataaaatgccgttg
gcggaaattattacccatccgggtacttccgataagacaatagccacaacggtttctctg
gccaagaagcagggtaaaactccgatagtggtgaaagatggtgccggattctatgtaaac
cgaattcttgcgccctacatgaacgaagctgcgcgcttgctgttagccggagagcctatt
gagcatatcgataaaaccttagtgaaatttggtttcccggtagggccaattactttactg
gatgaggttggtatcgatgttgcggcaaaagtggctccggtattggtgaaagagctgggt
gatcgttttgaagcgcctgaagcttttgagaagctgattgacgacgaccgtaaaggtaag
aaaaaccaaaaaggcttttatcaatacggcaagagtgtaaagggtaagccggtagacact
tcagtgtattctttgctggatattgatccgaacgagagcaagtctgcggacgaaattatt
gatatttgtttattgcccatgctgaatgaagctgcttactgtttgcaggaagagattatt
cgcagtcctcgcgacggtgatattggtgcaattttcggtatcggtttcccacctttcctt
ggcgggccattccgttatatggacagccaggggcttgaaacgatagtgaataagctagag
aagctggcagcagaacgtggcgaacgatacacgcctgcacctttgttgaagcaaatgctg
gaaaatggctggaatttctatcaatag

DBGET integrated database retrieval system