KEGG   Idiomarina loihiensis L2TR: IL1086Help
Entry
IL1086            CDS       T00218                                 

Gene name
ruvA
Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    IL1086 (ruvA)
Enzymes [BR:ilo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     IL1086 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1170937..1171554)
Genome map
AA seq 205 aa AA seqDB search
MIGHIQGVLTSKQPPEVVLDVQGIGYEIQLPMTCFYQLPPVGETIKLITHFVVREDAQLL
YGFISASERSLFRLLLKTQGVGPKLALAILSGMSADEFVMAVNQNDVTRLVKLPGVGKKT
AERLVIEMRDRLKDWQPSTPFTDRAPLDSQGMDAREHPADARTDAISALQSLGYKENQAE
KALQKVYSAEHNSETLIRLALKQLS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtcatattcagggcgtacttaccagcaagcaaccaccggaagtggtattagat
gtacagggcattggttatgaaattcagttgccaatgacctgcttctatcaattgccgccg
gtgggcgaaaccataaaattaatcacacattttgtggtgcgcgaagatgcacagctattg
tatggttttatttctgcttcagaacgttcgctgttccggttactactgaaaactcaggga
gttggcccgaaactggctttggccattttatccggcatgtcagcagatgagtttgtcatg
gctgtgaaccaaaacgatgttactcgtttggtgaaattgccaggtgtaggcaaaaagacc
gccgaacgtctggttattgaaatgcgtgaccgactcaaagactggcagccgtctacgcca
tttaccgaccgtgcaccgctggatagccagggtatggatgcaagagaacatccggccgat
gcaagaaccgatgctattagcgccttgcagtcacttggctataaagaaaatcaagctgaa
aaagccctgcaaaaagtgtactctgcagaacataacagtgagaccttgattcgactggcg
ctaaagcagctgtcgtaa

DBGET integrated database retrieval system