KEGG   Idiomarina loihiensis L2TR: IL1094Help
Entry
IL1094            CDS       T00218                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IL1094 (galU)
   00052 Galactose metabolism
    IL1094 (galU)
   00500 Starch and sucrose metabolism
    IL1094 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    IL1094 (galU)
Enzymes [BR:ilo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     IL1094 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1178896..1179780)
Genome map
AA seq 294 aa AA seqDB search
MVKKVVIPVAGLGTRMLPATKAIPKEMLPLVDRPLIQYIVEECAAAGLTDVILVTHSSKN
SIENHFDTSFELETTLEQRVKRQLLAEVKAICPEKTTIMHVRQGVAKGLGHAVLCARPLI
GDEPFAVVLPDVLVDDASCKLNRDNLAEMVKNFEASGHSQVMVEKVPQQDVNKYGIADIN
GAELSPGEQAGITQLVEKPSVEDAPSDLAVVGRYVFSADLWSLLEKTPVGAGNEIQLTDA
MAMLLEKQPVNAYYMKGKSHDCGNKLGYAQAFVEHALRHPDLGADMKAYIQSLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaaaagtcgttattccagtagccgggctcggaactcggatgttacctgctacc
aaagccattcccaaagagatgttgccgttggtcgatcgcccccttattcaatacattgtt
gaggaatgcgccgctgcaggtttgaccgatgtgattctggttactcattccagtaaaaac
tcgatagaaaatcactttgacacgagttttgagctggagacgactttggagcagcgggta
aagcggcaactgttggctgaggtgaaggccatttgtcctgaaaaaactacaattatgcat
gttcgtcagggtgttgcaaaaggcctggggcacgctgttctgtgcgcgcgtccattaatc
ggagacgagccttttgctgtcgtattacctgacgttctggttgatgacgccagttgtaag
ctgaatcgcgataacttagctgaaatggtgaaaaactttgaagcaagcgggcattcgcaa
gtcatggtcgaaaaagtgccgcagcaagacgtcaataagtatggcatagccgatattaat
ggcgcggagttgagtccgggtgaacaggctggtattactcaactggttgaaaagccgtca
gttgaagatgcaccgtcagatttagccgtagttggtcgctatgtcttttcagctgattta
tggtcgctgttggagaaaacaccggtgggtgcgggcaatgaaattcagttgactgatgcc
atggcaatgctgctggaaaaacaaccggttaatgcgtattacatgaaaggcaagagccac
gactgtggcaataagctagggtacgctcaggcgtttgttgaacatgctttgcgacacccg
gatttgggcgccgacatgaaagcctacattcagtctctgaaataa

DBGET integrated database retrieval system