KEGG   Idiomarina loihiensis L2TR: IL1211Help
Entry
IL1211            CDS       T00218                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IL1211 (pfkA)
   01230 Biosynthesis of amino acids
    IL1211 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IL1211 (pfkA)
   00030 Pentose phosphate pathway
    IL1211 (pfkA)
   00051 Fructose and mannose metabolism
    IL1211 (pfkA)
   00052 Galactose metabolism
    IL1211 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    IL1211 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    IL1211 (pfkA)
Enzymes [BR:ilo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     IL1211 (pfkA)
Protein phosphatases and associated proteins [BR:ilo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     IL1211 (pfkA)
Messenger RNA biogenesis [BR:ilo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     IL1211 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1300323..1301357
Genome map
AA seq 344 aa AA seqDB search
MSSVNTINRIAIITSGGDAPGMNAALRAVVLAAENYGIEVMGFRHGYEGLLTNDFVKLDR
EDVEHILQYSGTIIKSARSERFKSEEGGREAATNLDAHQIDAFIVIGGDGSFRGAEHLAN
FWKGPIIGIPGTIDNDLFGTDNTIGYDTAVETAMDALDKIRDTAEAMDRVFIVEVMGRNA
GYIGISSAMACGAERMILPELQKDKPLTVDALVKHIESVQRVRGDSSYVMVLCENQWPGG
AVRLAEQLEDRLNLPCRPCLLGHVQRGGRPTAMDRILGTRLGVHAVELVRQGKTAVMAGV
TANELSETPLIDTWTKRKKLSEELINIQQSLFNPIKKDRNKSTQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatctgttaacacaataaaccgcattgccattataaccagtggtggcgatgccccc
ggtatgaacgccgcactccgtgctgtggttctcgctgctgaaaactatggcatagaagtc
atgggatttcgtcatggctatgaaggcctgctgactaacgactttgtaaaacttgaccgc
gaagacgttgagcacattttacaatattccggcaccattattaaaagcgcccgcagcgag
cgttttaaaagtgaagaaggtggacgggaagccgcaacgaatttagacgcacaccaaatt
gacgcctttatcgttattggcggcgacggctcgttccgtggcgctgagcatctggctaat
ttctggaaaggtcctattataggcatacccggcaccatcgataatgatctctttggcacc
gataacactattggctatgacacagcagtagaaaccgccatggatgcgctggataaaatc
cgcgataccgccgaggccatggatcgtgtctttattgtcgaagttatggggcgcaacgcc
ggttatatcggtattagcagcgctatggcctgtggtgccgagcgaatgattctgccagag
ctgcaaaaggataaaccattaacggttgatgcgctggttaagcacattgaatcggtacag
cgtgttcgcggcgactcaagctacgtgatggtgttatgcgaaaaccaatggcccggtggt
gcagttcgacttgcggaacagttagaggatcgtcttaacttaccttgtcgtccctgttta
cttgggcacgttcagcgcggtggacgccctacggcaatggatcgtattttaggaacgcgg
ctgggtgtgcatgcggttgaactcgttcgccagggaaaaacagcggttatggccggtgtt
acagcgaatgagctcagcgaaacaccattaattgacacctggacaaaacgtaaaaagctc
agtgaagagctcatcaacattcaacaaagtctgtttaacccgatcaaaaaagatcgcaat
aaatcgactcagtaa

DBGET integrated database retrieval system