KEGG   Idiomarina loihiensis L2TR: IL1212Help
Entry
IL1212            CDS       T00218                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ilo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301376..1302290
Genome map
AA seq 304 aa AA seqDB search
MPLTPLPVPLNDPSRPFFGSQYSTDIHPGHTHILGFGFDGTACFRKGTREGPDGLRAVSE
DIESYSPYLDADLEDQTFYDLGNLRLGFDDDEEKQWHHAVHDFNAIFDSLDLAKEQIKLL
TLGGEHSISYAPIVKYLKQYPDMVLLHLDAHADLRDGFLGYHYSHASIIRRSVDHFGPGH
ELIQYGIRSGTRDEYQWMKEHKTIRSSRKDFLDSVEAIAKDRPVYLTLDLDYFDPSFLPG
TGTPEPGGEDFHSFVSLMKLLRKKNLVGADVVELSPQIDPTGNSDVFAAKIVRELLLVLQ
QSGA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcccctaacgccactacctgtgccattaaacgacccgagccgcccatttttcggttcg
caatacagcaccgatatacacccgggacatacccatattctggggtttggttttgatggt
accgcctgttttcgtaaaggcacccgcgaagggcctgacggtttacgtgccgtttctgaa
gacatcgagtcatactcgccgtatcttgatgctgacttagaagaccaaaccttctacgac
ttaggcaacctgcgattgggttttgatgacgacgaagaaaagcagtggcaccatgcggtt
cacgactttaatgctatttttgactcgcttgatttagcaaaagagcagattaaactgctg
accttgggtggcgagcattctatttcctatgcgcctatcgttaaatatttaaaacaatac
cccgatatggttttgctgcatctggatgcgcacgctgatttacgtgacggtttcctcggc
taccattattcacatgcgtctattattcgtcgttcagtcgaccactttggtcctggccat
gagttgatacagtacggtatccgctctggcacgcgcgatgaatatcagtggatgaaagaa
cacaaaaccattcgcagttcacgcaaagactttctcgacagtgtggaagccattgccaaa
gaccgcccggtttatctgacgttagatttggactacttcgatccttcttttttaccgggc
acaggaacccctgaacccggcggcgaggatttccattcctttgtcagcttgatgaaacta
ttgcgcaaaaaaaacctggtcggtgccgacgtcgttgagttgtctccacaaatagaccca
accggaaattctgacgtattcgccgctaaaattgtgcgcgaattattactcgtattacaa
cagtcgggagcctga

DBGET integrated database retrieval system