KEGG   Idiomarina loihiensis L2TR: IL1501Help
Entry
IL1501            CDS       T00218                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00020  Citrate cycle (TCA cycle)
ilo00640  Propanoate metabolism
ilo00660  C5-Branched dibasic acid metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
Module
ilo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ilo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IL1501 (sucC)
   00640 Propanoate metabolism
    IL1501 (sucC)
   00660 C5-Branched dibasic acid metabolism
    IL1501 (sucC)
Enzymes [BR:ilo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     IL1501 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAV82339
UniProt: Q5QU21
Position
complement(1608055..1609221)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFKEFGLPVSEGYACDTADEAVEAAKRIGGDIWVVKCQVHAGGRGKAGGV
KLVKSLDDVRAFAEQWLGKNLVTFQTDEKGQPVAKILVESCTDIADELYLGAVVDRASRK
IVFMASTEGGVEIETVAEETPEKILKAEIDPTVGAQPYQGRELGFKLGLTPDQVKQFTKV
FMGLAKMFEQYDLALLEINPLVITDEGNVHCLDAKVGIDSNALYRQPKIREMHDPSQDDA
REAEAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVKLSGGEPANFLDVGGGATKERVSE
AFKIILSDSSVKAVLVNIFGGIVRCDMIAEGIIGAVEEVGVKVPVIVRLEGNNAELGTQK
LNESGLNIIAAESLSDAADKVVAAAGGQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcagggtaaacaactctttaaagagtttggtttgccagtatct
gaaggttatgcctgcgacactgctgatgaagcggtagaagcggcaaaacgtattggtggc
gacatttgggttgtcaaatgtcaggttcacgctggtggccgcggtaaagcgggtggcgtg
aaattagtgaaaagtttagacgacgttcgcgcattcgctgagcagtggttaggtaaaaac
ttagtaactttccagaccgacgagaaaggtcagccggttgctaagattttagttgaaagc
tgcactgacattgcagacgagctttacttaggtgcagttgttgaccgtgcttcacgcaaa
atcgtgttcatggcatcaaccgaaggcggcgtagaaattgaaaccgttgctgaagaaaca
cctgagaaaatcttgaaagctgaaattgaccctacggttggtgcgcagccataccaaggt
cgcgagctaggctttaaactgggtctgactccagaccaggttaagcagttcactaaggtc
ttcatgggcctggcgaaaatgttcgaacagtacgacttagcgctgttagaaattaaccca
ttggttattactgacgaaggcaacgttcactgtctggatgcgaaagttggcatcgacagc
aacgcattgtaccgtcagcctaaaatccgtgaaatgcacgatccgtcacaagacgacgca
cgtgaagcagaagcggctaaatgggaactgaactacgtagcactagacggcaacattggt
tgcatggttaacggtgctggtttggcgatgggtactatggacatcgttaaactgagtggc
ggcgaaccagctaacttccttgacgttggtggcggcgcgacaaaagaacgtgtttctgaa
gcgttcaaaattatcctgtcagacagctctgttaaagccgtattggttaacatcttcggt
ggtatcgtacgttgcgatatgattgctgaaggtattatcggcgctgttgaagaagtgggt
gttaaagtaccggttattgttcgccttgaaggtaacaacgctgaactgggtacccagaaa
ttgaacgaaagtggcctgaacattatcgctgcagagagcttatctgatgctgccgataaa
gtggttgctgcggcaggaggtcaataa

DBGET integrated database retrieval system