KEGG   Idiomarina loihiensis L2TR: IL1502Help
Entry
IL1502            CDS       T00218                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00020  Citrate cycle (TCA cycle)
ilo00310  Lysine degradation
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
Module
ilo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ilo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IL1502 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    IL1502 (sucB)
Enzymes [BR:ilo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     IL1502 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AAV82340
UniProt: Q5QU20
Position
complement(1609358..1610920)
Genome map
AA seq 520 aa AA seqDB search
MAIDIKVPQLPESVADATIATWHVKPGDKVSRDQNLVDIETDKVVLEVVAEADGVLGEIT
AEEGTTVTAEEVIGKIEEGDGASASDDKSDNKDSDDDKKSEKKESDSSEDKGSDKKGSGE
KMEVKVPQLPESVSDATVSTWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGVLAEIKH
EEGATVGADDVIGIVEAGGSAGGSSSKSDDSKSESSSESKDDDGDNEVAGPAVRRLLGEH
GLKPSDVKGTGKGGRVTKEDVEKHVKAQSSKSSDSSKQQSSQPAVSGDRDQKRVPMTRLR
KRIAERLLQAKNDTAMLTTFNEINMKPIMDLRKKYKDVFEETHGTRLGFMGFYVKAVTEA
LKRFPDVNASIDGDDIVYHNFFDISIAVSTPRGLVTPVLRDTDRLSIADMENGIRDLAIK
GRDGKLTMDEMQGGNFTITNGGVFGSLLSTPILNPPQSAILGMHKIQERAMVVDGKIEIL
PMMYLALSYDHRIIDGKQSVGFLVTVKELLEDPQRLILDI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgatattaaagttcctcaattacccgagtctgttgcagatgcaacaattgca
acatggcacgtaaaacctggcgataaagtgtctcgcgaccagaatctggttgacatcgaa
accgacaaggtagtgctggaagtggttgcggaagcagacggtgttttgggcgaaattact
gccgaagaaggcactaccgtaacagctgaagaagttatcggaaaaattgaagaaggtgac
ggtgcgtcggcatctgacgataaatcagacaataaagactcagacgacgacaagaagtca
gagaaaaaagaatctgattcttcagaagacaaaggctctgacaaaaaaggttctggcgag
aaaatggaagttaaagttcctcaactgccagaatcagtctctgatgccactgtttctacc
tggcacgttaaagctggcgatgcagtaaaacgtgaccagaacctggttgatattgaaacc
gataaagtggttctggaagtggttgctccggctgatggcgttttagctgaaattaagcac
gaagaaggcgcgacagtcggtgctgatgacgttatcggtattgtcgaagctggtgggtct
gctggcggtagttcaagcaagtccgatgacagcaaatctgaatcttcttcagaaagtaaa
gacgatgacggtgacaacgaagtagcgggtcctgcggttcgtcgtttacttggtgaacac
ggccttaagccaagtgacgttaaaggcactggtaagggcggtcgcgtcactaaagaagac
gtggaaaaacacgtgaaagctcagtcttctaagtcttcggatagcagcaaacagcagtct
tcacagccagccgtttcaggtgaccgtgaccagaaacgtgtaccaatgacacgtctgcgt
aaacgtatcgctgagcgtctgttgcaagctaagaacgacaccgcgatgttgaccacgttt
aacgaaatcaacatgaagccaattatggacttgcgtaagaagtacaaagacgtgtttgaa
gaaactcacggcacgcgtcttggtttcatgggcttctacgtcaaagctgtaactgaagca
ctgaaacgtttcccagacgtcaacgcatccattgatggcgacgatattgtttaccacaat
ttcttcgatatcagcattgcggtatcaacgcctcgtggtctggtaactccagttctgcgc
gacactgaccgtttaagcattgcggatatggaaaatggtattcgtgacctggctatcaaa
ggccgtgacggtaagttaactatggatgaaatgcagggtggtaatttcaccattactaac
ggtggtgtatttggttcactgctttcaacgccaattctgaacccaccacaaagcgctatt
ctgggtatgcacaaaatccaggagcgggcgatggtggtagacggtaagatcgaaatctta
ccgatgatgtacctggctctttcttatgaccatcgaattattgatggtaaacaatcggta
ggtttcctggttaccgtgaaagagctattagaagatcctcaacgtcttatcctggatatc
taa

DBGET integrated database retrieval system