KEGG   Idiomarina loihiensis L2TR: IL1502Help
Entry
IL1502            CDS       T00218                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IL1502 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IL1502 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    IL1502 (sucB)
Enzymes [BR:ilo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     IL1502 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609358..1610920)
Genome map
AA seq 520 aa AA seqDB search
MAIDIKVPQLPESVADATIATWHVKPGDKVSRDQNLVDIETDKVVLEVVAEADGVLGEIT
AEEGTTVTAEEVIGKIEEGDGASASDDKSDNKDSDDDKKSEKKESDSSEDKGSDKKGSGE
KMEVKVPQLPESVSDATVSTWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGVLAEIKH
EEGATVGADDVIGIVEAGGSAGGSSSKSDDSKSESSSESKDDDGDNEVAGPAVRRLLGEH
GLKPSDVKGTGKGGRVTKEDVEKHVKAQSSKSSDSSKQQSSQPAVSGDRDQKRVPMTRLR
KRIAERLLQAKNDTAMLTTFNEINMKPIMDLRKKYKDVFEETHGTRLGFMGFYVKAVTEA
LKRFPDVNASIDGDDIVYHNFFDISIAVSTPRGLVTPVLRDTDRLSIADMENGIRDLAIK
GRDGKLTMDEMQGGNFTITNGGVFGSLLSTPILNPPQSAILGMHKIQERAMVVDGKIEIL
PMMYLALSYDHRIIDGKQSVGFLVTVKELLEDPQRLILDI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgatattaaagttcctcaattacccgagtctgttgcagatgcaacaattgca
acatggcacgtaaaacctggcgataaagtgtctcgcgaccagaatctggttgacatcgaa
accgacaaggtagtgctggaagtggttgcggaagcagacggtgttttgggcgaaattact
gccgaagaaggcactaccgtaacagctgaagaagttatcggaaaaattgaagaaggtgac
ggtgcgtcggcatctgacgataaatcagacaataaagactcagacgacgacaagaagtca
gagaaaaaagaatctgattcttcagaagacaaaggctctgacaaaaaaggttctggcgag
aaaatggaagttaaagttcctcaactgccagaatcagtctctgatgccactgtttctacc
tggcacgttaaagctggcgatgcagtaaaacgtgaccagaacctggttgatattgaaacc
gataaagtggttctggaagtggttgctccggctgatggcgttttagctgaaattaagcac
gaagaaggcgcgacagtcggtgctgatgacgttatcggtattgtcgaagctggtgggtct
gctggcggtagttcaagcaagtccgatgacagcaaatctgaatcttcttcagaaagtaaa
gacgatgacggtgacaacgaagtagcgggtcctgcggttcgtcgtttacttggtgaacac
ggccttaagccaagtgacgttaaaggcactggtaagggcggtcgcgtcactaaagaagac
gtggaaaaacacgtgaaagctcagtcttctaagtcttcggatagcagcaaacagcagtct
tcacagccagccgtttcaggtgaccgtgaccagaaacgtgtaccaatgacacgtctgcgt
aaacgtatcgctgagcgtctgttgcaagctaagaacgacaccgcgatgttgaccacgttt
aacgaaatcaacatgaagccaattatggacttgcgtaagaagtacaaagacgtgtttgaa
gaaactcacggcacgcgtcttggtttcatgggcttctacgtcaaagctgtaactgaagca
ctgaaacgtttcccagacgtcaacgcatccattgatggcgacgatattgtttaccacaat
ttcttcgatatcagcattgcggtatcaacgcctcgtggtctggtaactccagttctgcgc
gacactgaccgtttaagcattgcggatatggaaaatggtattcgtgacctggctatcaaa
ggccgtgacggtaagttaactatggatgaaatgcagggtggtaatttcaccattactaac
ggtggtgtatttggttcactgctttcaacgccaattctgaacccaccacaaagcgctatt
ctgggtatgcacaaaatccaggagcgggcgatggtggtagacggtaagatcgaaatctta
ccgatgatgtacctggctctttcttatgaccatcgaattattgatggtaaacaatcggta
ggtttcctggttaccgtgaaagagctattagaagatcctcaacgtcttatcctggatatc
taa

DBGET integrated database retrieval system