KEGG   Idiomarina loihiensis L2TR: IL1506Help
Entry
IL1506            CDS       T00218                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00020  Citrate cycle (TCA cycle)
ilo00190  Oxidative phosphorylation
ilo00650  Butanoate metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
Module
ilo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ilo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ilo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IL1506 (sdhD)
   00650 Butanoate metabolism
    IL1506 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    IL1506 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AAV82344
UniProt: Q5QU29
Position
complement(1616346..1616693)
Genome map
AA seq 115 aa AA seqDB search
MVTAAATFGRSGSHDFILLRASAIVMVLYSLFMAGFFLSTPDVTYQVWSGLFANIWMKVF
TMLALSSVLIHGWIGIWQVSTDYVKASGLRAFIQLVFSVGLIAVWLTGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagcagcagctacttttggtcgtagcggttctcatgactttattttattgaga
gccagcgcgattgtaatggttctatattcactgttcatggctgggttcttcctttctacg
ccagatgtaacttatcaagtgtggagtgggttgtttgccaacatttggatgaaagtgttc
actatgctggccttatcttctgtgttaattcacggctggattggcatttggcaagtatca
acagactacgtgaaagcgtccggtctcagagcttttatccaactggttttcagcgttggt
ctgatcgctgtttggctcactggcttattcgtactgtggggtgtttaa

DBGET integrated database retrieval system