KEGG   Idiomarina loihiensis L2TR: IL1688Help
Entry
IL1688            CDS       T00218                                 

Gene name
accA
Definition
AcetylCoA carboxylase, carboxytransferase component subunit alpha
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IL1688 (accA)
   01212 Fatty acid metabolism
    IL1688 (accA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IL1688 (accA)
   00640 Propanoate metabolism
    IL1688 (accA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    IL1688 (accA)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    IL1688 (accA)
Enzymes [BR:ilo01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     IL1688 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1811695..1812651)
Genome map
AA seq 318 aa AA seqDB search
MSLNFLDFEQPIAELEAQIEELKSVGNRGQLDLNLEEEVQRLTTKSQELTEKIFSDLGAW
QVAQLARHPLRPYTLDYIRMIFTEFDEMAGDRSFANDEAIVGGIARLDGTPVMVIGQQKG
RETKEKIRRNFGMPKPEGYRKALRLMQTAERFKMPIVTFIDTPGAYPGIGAEERGQSEAI
ARNLKVMARLTVPIVCTVIGEGGSGGALAIGVGDRVNMLQYSTYSVISPEGCASILWKSA
SKAPLAAEAMGVTAERSKELGLVDSVIPEPLGGAHRHQEEMAVRLKRQLIADLGSLQGLS
HEELLDQRYRKLMSFGYC
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagccttaattttctggattttgaacaacctattgcggaacttgaagcgcaaatcgaa
gaactgaagtctgttggcaaccgcgggcaactggatcttaacttagaagaggaagtgcag
cgactgaccaccaagagtcaggaactgacagagaaaatcttttctgatttaggtgcgtgg
caggttgcacagctggcgcgtcatccgttgcgtccttacacgcttgactatattcgcatg
atattcaccgagtttgacgaaatggcgggtgatcgctcttttgctaatgacgaggcgatt
gttggcggtattgcgcgtttagacggcactccggttatggttataggccagcaaaaaggc
cgtgaaaccaaagagaagatccgtcgtaactttggtatgccaaagccggaaggttatcgt
aaggcgctacgcctgatgcaaaccgccgagcgttttaaaatgccaattgttaccttcatt
gatacacctggagcttacccgggaattggtgcggaagagcgcggtcagagtgaagccatt
gcacgtaacctgaaagttatggctcgtttaaccgttcctattgtttgtactgttattgga
gaaggtggttctggtggtgctctggctattggtgtcggtgaccgcgttaacatgctgcaa
tacagtacgtactcggttatttctccggaaggttgtgcttctattttgtggaaaagtgcc
agcaaagcgccattagcggcagaagctatgggcgtaaccgcagagcggagtaaagagctg
ggtctggttgattctgtgatacctgaacctttaggcggcgcgcaccgccatcaggaagaa
atggcggtacgccttaagcgtcagctgattgctgatttaggaagcttacagggcttaagc
catgaggaattgctggaccagcgttatcgtaaactcatgtcttttggttactgctaa

DBGET integrated database retrieval system